KEGG   Rattus norvegicus (rat): 290409Help
Entry
290409            CDS       T01003                                 

Gene name
Olfm4
Definition
(RefSeq) olfactomedin 4
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: OLF FPP
Motif
Other DBs
NCBI-GeneID: 290409
NCBI-ProteinID: NP_001099522
RGD: 1311708
Ensembl: ENSRNOG00000013280
UniProt: D3ZMI6
Position
15q12
AA seq 511 aa AA seqDB search
MCYSRLLLLSLLFCLGSASGSSRALSSTHSLELTTPTLPETTLPETTTAWLPSGGTSWTE
GGTLSQSLSNFTGSVDSHGTCQCSVSLPDTTFPADRVERLEFTAHTLSQKFEREFSKVKE
YVQLISVYEKKLLNLTVRVEVMEKDSISYTELDFELIKLEVKEMHKLVIQLKENFVGSTD
IIDMLEVEIRNMTLLVEKLETLDQNNVLSIRRQILALKTKLKECEDSKSGLVPATPPPPA
PGSCSHGGVVNISAPFVVQLNFQGFNYKYGAWGRDYSPQHPERTLYWVAPLNTDARVLEY
YRLYDSLDNLLLYSHSRQYRILYGQGGGTVAFNNSLYVNWYNGRNIAKIDLTTNGVTVNQ
PLPQAAYNNRFSYANVNWQDIDLAVDEQALWAIYATEASTGNIVISKLNDTTLEVISTWV
TKQYKPSVSNAFIVCGVLYATRTLNTRTEEIFYYYDTNTQREGSLAITMRKMQERIQSIN
YHPYDHKLYVYNDGYLLNYDLVFLQTPKQPV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtgttacagccgtcttctcctcctgtcccttctgttctgccttggctctgcctctggg
agttcgagagctctgagctctacacattccctggaattgaccactccaacattacctgag
actacattacccgagactacgactgcctggctgccttcgggaggcacgtcgtggacagaa
ggtggtactctgtctcagtcactttccaatttcactgggtctgtggacagccatgggacc
tgccagtgttctgtttccctgccggacaccacttttcctgctgacagagtggagcgcttg
gagttcacagctcacaccctttctcagaaatttgagagagagttttctaaggtgaaggag
tatgtccagctaataagtgtgtatgagaagaagctcctgaacctgactgtccgagtagag
gtcatggagaaggacagcatttcttatacagaactggactttgagttgatcaagctagaa
gtgaaggagatgcacaaactggtcatacagctgaaggagaactttgttggaagtacagat
attattgacatgcttgaagtggagataaggaatatgactctcctggtagagaagctggag
acgctagaccaaaacaatgtccttagcattcgccggcagatcttggctctgaagaccaag
ctgaaggaatgtgaggactctaaaagtggccttgtgcctgccacaccccctcctcctgct
cctggaagctgtagccatggcggtgtggtgaacatcagcgctccttttgtggttcagctc
aactttcaagggtttaattataaatatggtgcctggggccgagattactctcctcagcat
ccagagagaaccctgtactgggtggcacctttgaatacagatgccagggttctagagtat
tacagactttatgactcactggataatctgttactctattcacattccagacagtatcgg
attctctatggccaagggggtggtacagtagcattcaacaacagcctgtatgtgaattgg
tacaatgggagaaacattgccaaaattgacctaactaccaatggagtcactgtgaatcag
cccctccctcaggctgcctacaataaccgcttttcatatgctaatgtgaattggcaagac
attgaccttgctgtggacgagcaagcactgtgggcaatttatgcaactgaggccagcact
ggtaacatagtgattagtaagctcaatgataccactcttgaggtgataagcacttgggtt
accaagcagtacaagccatctgtttctaatgccttcattgtatgtggagttctttacgct
actcgcactttgaacaccagaacagaagagatcttttactactatgacacaaacacacag
agggaaggcagtctagccatcacaatgagaaagatgcaggaaagaattcagagcattaat
tatcatccctatgaccacaaactttatgtctacaatgatggttatcttttgaactacgat
cttgtcttcttacagacacctaagcaacctgtctaa

DBGET integrated database retrieval system