KEGG   Rattus norvegicus (rat): 290426
Entry
290426            CDS       T01003                                 

Gene name
Klhl1
Definition
(RefSeq) kelch-like family member 1
  KO
K10442  kelch-like protein 1/4/5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    290426 (Klhl1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     290426 (Klhl1)
SSDB
Motif
Pfam: BACK BTB
Other DBs
NCBI-GeneID: 290426
NCBI-ProteinID: NP_001099524
RGD: 1307452
Ensembl: ENSRNOG00000031100
UniProt: D4A9J8
Position
15q21
AA seq 494 aa
MSGSGRKDFDVKHILRLRWKLFSHPSPASGSSAGGSCLQQDSGGGSFEHWGPSQSRLLKN
QEKGSVSAFWKKPSSSSTSSSSSSSASSSPFSPLNGTLLPVATRLQQGAPGQGTQQPART
LFYVESLEEEVVTGMDFPGPQDKGLALKELQAEPASSIQATGEGCGHRYSKFLPSRLTTT
NHSLTPQSDLDSSSSEEFYQAVHHAEQSFRKMENYLKQQQLCDVILIVGNRKIPAHRLVL
SSVSDYFAAMFTSDVCEAKQEEIKMEGIDPNALWDLVQFAYTGCLELKEDTIENLLAAAC
LLQLPQVVEVCCHFLMKLLHPSNCLGIRAFADAQGCIELMKVAHSYTMENIMEVIRNQEF
LLLPAEELHKLLASDDVNVPDEETIFHALMMWVKYDMQRRCGDLSMLLAFIRLPLLPPQI
LADLENHALFKNDLECQKLILEAMKYHLLPERRTLMQSPRTKPRKSTVGTLYAVGGMDNN
KGCIQLGAEMEVLV
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgtccggctctgggcgaaaagatttcgatgtgaagcacatcctgcgactccgctggaaa
ctcttcagccatccctcaccagcctccggtagctcagcggggggcagctgcctgcaacag
gacagcgggggaggcagctttgagcactggggtcctagccagagtcggctgctcaaaaac
caggaaaagggcagtgtgagcgctttctggaaaaaaccttcttcctcttcgacatcatca
tcatcctcgtcctctgcttcatcctctcctttcagtccgctgaatggcaccttactacca
gttgccacgaggctgcaacaaggggctcctgggcagggcacccagcagcccgccaggact
cttttctacgtggagtccctagaggaggaggtagtgacaggcatggactttcctggacca
caggacaaaggattggccctgaaagagctccaagcagagcctgccagctctatccaggca
acaggtgaaggatgtggacacaggtacagtaagttcctaccaagcaggttgacaacgacc
aatcattcactgacacctcaaagtgatttggactccagtagctctgaagaattctatcaa
gctgttcaccatgctgagcaatcatttaggaagatggagaattatctaaagcaacagcag
ctgtgtgatgtcatcctgatagtggggaatcgaaagatacctgctcataggcttgtcctg
agctctgtctctgactactttgctgccatgtttacaagcgatgtctgtgaagccaagcaa
gaggagatcaagatggaaggcatagacccaaatgcactctgggatcttgttcaatttgca
tatacaggttgcttggaattaaaagaggacactattgaaaaccttcttgcagccgcgtgc
cttctccagctccctcaagtggtcgaagtgtgttgtcacttcctcatgaaacttcttcat
ccatccaactgcttaggaatccgggcatttgcagacgctcaaggatgtattgaattaatg
aaggtggcacacagctacaccatggaaaacataatggaagtaatcagaaatcaagagttt
ttactccttccagccgaagagctccataaactactggccagtgatgacgtaaatgtgcct
gatgaagagaccatcttccatgcattaatgatgtgggtcaagtacgacatgcagcggaga
tgcggcgacctgagtatgctcctcgccttcataagactgccactgcttccaccacagata
ctggctgaccttgagaatcatgcactattcaagaatgatttagaatgtcaaaaactgatt
ctggaagcaatgaaataccatctattgccagaaagaagaactttaatgcaaagcccaaga
actaagcccagaaaatctacagttggaactctttatgcggtggggggaatggataataac
aaaggttgtattcagttgggggccgagatggaagttcttgtttga

DBGET integrated database retrieval system