KEGG   Rattus norvegicus (rat): 290467
Entry
290467            CDS       T01003                                 

Gene name
Slitrk6
Definition
(RefSeq) SLIT and NTRK-like family, member 6
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 TPKR_C2 LapA_dom
Other DBs
NCBI-GeneID: 290467
NCBI-ProteinID: NP_001099527
RGD: 1306550
Ensembl: ENSRNOG00000022337
UniProt: D3ZP44
Position
15q23
AA seq 840 aa
MKLRICLLYPSLLACLSLQSQSPMPPVRGSCDTLCTCEEKDGIMIINCEEKGINTLSQIS
VPPSRPFHLSLLNNGLTTLHTNDFSGLTNALSIHLGFNNIADIETGAFNGLGLLKQLHIN
HNSLEILKEDTFHGLENLEFLQADNNFITVIEQSAFSKLNRLKVLILNDNAIESLPPNIF
RFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKWACNCELLQLKNWLENMPPQS
IIGDVICYSPPLFKGSILSRLKKESICPTPPVYEEHEDPAGSLLAITSSTSDSRLSSKNT
SILKQPTKAPGSVPYLTKPSTQLPVPYCPVPCNCKVLSPSGLLIHCQERNIESVSDLQPP
PHNPRKLILAGNIIHTLMKADLMDYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNGN
HLTKLYKGMFLGLSSLEYLYLEYNAVKEILPGTFNPMPKLKVLYLNNNLLHVLPAHIFLG
IPLTRVNLKTNQFTHLPVSNILDDLDLLIQIDLEDNPWDCSCDLVGLQQWIHKLGKGTVT
DDILCASPGHLDKKELKALNSELLCPGLVNNPSMPTQTSYIIVTSPTMAADAAGTLLSSL
TDAVPLSVLILGLLIVFITIVFCAAGIVVFVLHRRRRYKKKKVEEQLRDTSPVHLQYSMY
GHKTTHHTTERPSSSLYEQHMVSPMVHVYRSPSFGPKHLEEVEERSDKEGNDAKHLQRSL
LERENHSPLTGSNMKYKVVDQSTDFLPFQDASLLYRNILDKERELQQLGITEYLRKNIAQ
LQPDVEVNYPGAHEELKLMETLMYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQT
NT seq 2523 nt   +upstreamnt  +downstreamnt
atgaagctgaggatttgtctcctttatccctctcttcttgcttgtctatctctacagtcg
cagtcacccatgcccccagtcagaggctcttgcgacactctttgtacttgtgaagagaaa
gatggcataatgataataaattgtgaagaaaagggcatcaatacattatcccaaataagt
gtgccaccgtcacgacctttccacttaagtttattaaataatggcttgacaacgctccac
acaaatgacttttctgggcttaccaatgccctttcaatacaccttggatttaacaacata
gcagatatcgagacaggtgcatttaatggccttggacttcttaaacaacttcatatcaat
cacaattccttggagattctcaaagaggataccttccacggtttggagaacctggaattt
ttgcaggctgataataatttcattacagtgattgaacagagtgccttcagtaagctcaac
aggctgaaagtgttaattttaaatgacaatgccatcgagagtcttcctccaaacatattt
cgattcgttcctttaacccatctagatcttcgtggaaaccagttgcaaacgttgccttat
gttggctttttagaacacattggccggatattggatctccagttggaggacaataagtgg
gcctgcaattgtgaattattgcagctaaagaactggctggaaaatatgcctccacagtct
atcattggtgacgtcatatgctacagccctccacttttcaaaggaagcatactgagccga
ttgaaaaaggaatctatttgccctactcccccagtgtatgaagagcacgaggacccagca
gggtctttgttggccataacatcttccacaagtgacagccgcctatcaagcaagaataca
tccattttaaaacaacccaccaaagcgccaggttccgtaccttaccttacgaagccgtcc
actcagcttccggtaccctattgtcctgttccgtgcaactgcaaagttctctccccttca
ggacttctaatccactgtcaggaacgcaatattgaaagtgtgtcagatctgcaacctcct
ccacacaatcctagaaagctgatccttgcaggcaatattattcatactttaatgaaggct
gacctgatggactatttcacgttggaaatgcttcacttgggaaacaatcgtattgaagtt
cttgaagaagggtcatttatgaacctgacaaggctccagaaactctatctcaatggcaac
catctgaccaaactatataaaggcatgttccttggtctttccagtctcgagtatttgtat
ctcgagtacaatgcggtaaaggaaatattaccagggaccttcaacccaatgcctaaactg
aaagttctttatttaaataacaatctccttcacgttttaccggcacatatttttttaggt
attcctctaactagagtaaatcttaaaacaaaccaattcacccatttacctgtaagcaac
atcttagatgaccttgacttactgatacagattgaccttgaggataacccatgggattgc
tcctgtgacctggttggattgcagcaatggatacacaagcttggcaagggcaccgtgacg
gatgacatcctctgcgcttccccagggcatcttgacaaaaaggaattaaaagccctcaac
agtgaacttctctgccctggtttagtgaataacccttccatgccaactcagactagctac
attattgtcacttctcccacaatggcagccgatgcggctggtacccttttgagttcccta
actgatgctgtgcccctatcggttctgatattaggacttctgattgtgttcataactatt
gtattctgcgccgcggggatagtggtatttgtcctccaccgcagaagaagatacaagaag
aaaaaggtagaggagcaactgagagacaccagtcctgtacacctgcagtacagcatgtat
ggtcataaaacaactcaccatacaacggaaaggccctcttcctctctctacgaacagcac
atggtgagcccaatggttcacgtctacagaagcccatccttcggtccaaagcatttggaa
gaagttgaagaaagaagtgataaagaaggaaacgatgcgaagcatcttcaaaggagcctg
ttggaacgagaaaatcattcaccccttacaggttcaaatatgaaatacaaagtcgtagac
caatcaacagatttcctaccttttcaggatgcgagtttactatacaggaacattttggac
aaagaaagagaacttcagcagcttggcatcacagagtacctacggaaaaatattgctcag
ctccagccagatgtagaggttaactatcctggagcccacgaggagctgaaactaatggaa
actctgatgtactcacgacccaggaaggtgctggtagaacagactaaaaatgagtatttt
gagctcaaagcgaacttgcatgctgagcctgactatctagaagtcttggaacagcagaca
tag

DBGET integrated database retrieval system