KEGG   Rattus norvegicus (rat): 290493Help
Entry
290493            CDS       T01003                                 

Gene name
Oxgr1, Gpr80, P2Y15
Definition
(RefSeq) oxoglutarate receptor 1
  KO
K08419  oxoglutarate (alpha-ketoglutarate) receptor 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    290493 (Oxgr1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Alpha-ketoglutarate
    290493 (Oxgr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Abhydrolase_9_N
Motif
Other DBs
NCBI-GeneID: 290493
NCBI-ProteinID: NP_997471
RGD: 1303155
Ensembl: ENSRNOG00000037884
UniProt: Q6Y1R5
Position
15q24
AA seq 337 aa AA seqDB search
MIETLDSPANDSDFLDYITALENCTDEQISFKMQYLPVIYSIIFLVGFPGNTVAISIYVF
KMRPWKSSTIIMLNLALTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFGFHFNLYSS
ILFLTCFSLFRYIVIIHPMSCFSIQKTRWAVVACAGVWVISLVAVMPMTFLITSTTRTNR
SACLDLTSSDDLTTIKWYNLILTATTFCLPLLIVTLCYTTIISTLTHGPRTHSCFKQKAR
RLTILLLLVFYVCFLPFHILRVIRIESRLLSISCSIESHIHEAYIVSRPLAALNTFGNLL
LYVVVSNNFQQAFCSAVRCKAIGDLEQAKKDSCSNNP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgattgagacactggacagcccagccaatgattctgatttcctggattacataactgct
ttggaaaactgcactgatgagcaaatctcattcaagatgcagtaccttcccgtcatctac
agcatcatctttctcgtgggcttcccgggaaatacggtggcgatttccatctacgttttc
aagatgcgaccttggaagagcagtaccatcatcatgctgaacctggccttgacggacttg
ctgtatctgaccagcctccctttcctcatccattattacgcgagcggtgaaaactggatc
ttcggggatttcatgtgcaagttcatccgatttggcttccatttcaacctttacagcagc
atcctcttcctcacctgctttagcctcttccgttacattgtgatcattcacccgatgagc
tgtttttctattcagaagactcgatgggcggtggtggcttgtgctggggtgtgggtcatt
tctttggtagctgtcatgcccatgactttcctgatcacatcaaccacccggaccaatagg
tctgcttgccttgacctcaccagctcagatgacctcactactatcaaatggtacaatctc
attttgacggctaccactttctgcctgcccttgctgatagtgacactctgctacacgacg
attatcagcaccctgactcacggacctcggacccacagctgctttaagcagaaggctcgg
aggctgacgatcctgctcctccttgtgttctatgtatgctttttacccttccacatcctt
agggtcattcggatcgaatctcgcctgctttcaatcagctgctccatcgagagtcacatc
cacgaagcttacattgtctctaggccattagctgccctcaacacctttggcaacctgctg
ttatatgtcgtcgtcagcaataacttccagcaggcattctgctccgcagtgagatgtaaa
gccatcggggaccttgaacaagcaaagaaagacagttgctcaaacaacccctga

DBGET integrated database retrieval system