KEGG   Rattus norvegicus (rat): 290527
Entry
290527            CDS       T01003                                 

Gene name
Anxa11
Definition
(RefSeq) annexin A11
  KO
K17095  annexin A7/11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    290527 (Anxa11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    290527 (Anxa11)
   04147 Exosome [BR:rno04147]
    290527 (Anxa11)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   290527 (Anxa11)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   290527 (Anxa11)
  Exosomal proteins of other body fluids (saliva and urine)
   290527 (Anxa11)
  Exosomal proteins of colorectal cancer cells
   290527 (Anxa11)
  Exosomal proteins of bladder cancer cells
   290527 (Anxa11)
SSDB
Motif
Pfam: Annexin Ribosomal_S6e HSCB_C
Other DBs
NCBI-GeneID: 290527
NCBI-ProteinID: NP_001011918
RGD: 1309911
Ensembl: ENSRNOG00000010984
Vega: OTTRNOG00000001759
UniProt: Q5XI77
Position
16
AA seq 503 aa
MSYPGYPPPAGGYPPGAPGGAPWGGASYPPPSMPPIGLDNVANYAGQFNQDYLSGMAANM
SGTFGGANVPNMYPGAPGGGYPPVPPGGFGQPPPAQQPVPPYGMYPPPGGNPPPGMPSYP
AYPGAPVPGQPMPPPGQQPPGAYPGQPPMTYPGQSPMPPPGQQPVPSYPGYSGSSTITPA
VPPAQFGNRGTITDASGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSF
KTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDVYEIKEAIKGAGTDEACLIEILASR
SNEHIRELNRAYKTEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLVQRDVQ
ELYAAGENRLGTDESKFNAILCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEQGM
LAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSELDLLDIRAEYKRMYGKSLY
HDITGDTSGDYRKILLKICGGND
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgagctacccaggctacccaccacctgctggtggctaccctccaggtgcaccaggtggt
gctccctggggaggtgctagctaccctcctcccagcatgccccctatcgggctggataac
gtggccaactatgcagggcagttcaaccaggactacctctcgggcatggcagccaacatg
tctggaacattcggaggagccaacgtgccaaacatgtatcctggggctcctggaggtggc
tatcctccagtccctcctggtggctttgggcagccccctcctgcccagcagcctgtccct
ccttatggaatgtatccaccgccaggaggaaacccacctcctgggatgccctcataccca
gcatacccaggggccccggtgccaggccagcctatgccaccccctgggcagcagccccca
ggagcctatcctggacagcctccaatgacctatcctgggcagtcaccaatgccaccccct
gggcagcagccagtgccaagttacccaggatactcaggatccagtaccatcaccccggct
gtgcctccagctcagtttggaaacagaggcaccatcaccgatgcttctggatttgacccc
ttgcgagatgctgaggtcctgcggaaggctatgaagggcttcggaacggatgaacaggcc
attatcgactgcctagggagccggtccaacaagcagcggcagcagatcctgctgtccttc
aagacggcctatggcaaggatctgatcaaagacctaaagtcagagctgtcaggaaacttc
gagaagactatcctggccctgatgaagaccccggtcctgtttgatgtctatgagataaag
gaagctatcaagggggctggtactgatgaagcctgcctgattgagatcctggcttcccga
agtaacgagcacatccgggagctaaacagagcctacaaaacagagttcaaaaagactttg
gaggaggccattcgaagtgacacatcaggacacttccagagactcctcatctctctctct
cagggaaaccgtgatgaaagcacaaacgtggacatgtcccttgtccagagagatgtccag
gagctgtacgcagctggggagaaccgcctgggaacagatgaatccaagttcaacgcaatt
ctgtgctcccggagccgggcccacctcgtggcagttttcaacgagtatcagaggatgaca
ggccgagacatcgagaagagcatctgccgggagatgtctggggacctggagcagggcatg
ctggctgtggtgaaatgcctcaagaacacccctgccttctttgccgaaaggctcaacaag
gctatgaggggagcaggaacaaaagaccggaccctgattcgcatcatggtgtctcgaagc
gagcttgacctgctggatatccgagcagagtataagcggatgtacggcaagtcactgtac
cacgatatcacgggagacacttctggggattatcggaagatcctgctgaagatctgtggt
ggcaacgactga

DBGET integrated database retrieval system