KEGG   Rattus norvegicus (rat): 290549
Entry
290549            CDS       T01003                                 

Gene name
Selenok, Selk
Definition
(RefSeq) selenoprotein K
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: SelK_SelG
Other DBs
NCBI-GeneID: 290549
NCBI-ProteinID: NP_997472
RGD: 1303129
Ensembl: ENSRNOG00000014624
UniProt: P59798
Position
16p16
AA seq 94 aa
MVYISNGQVLDSRNQSPWRLSFITDFFWGIAEFVVFFFKTLLQQDVKKRRGYGGSSDSRY
DDGRGPPGNPPRRMGRISHLRGPSPPPMAGGUGR
NT seq 285 nt   +upstreamnt  +downstreamnt
atggtttacatctcgaatggtcaggtgttagacagccggaatcagtccccctggagattg
tctttcataacagatttcttctggggaatagcagaatttgtggttttttttttcaaaact
ctgcttcagcaagatgtgaagaaaagaagaggctacgggggctcctctgattccagatat
gatgacggaagagggccaccaggaaaccctccacgaagaatgggtcggatcagtcacctt
cgtggccccagccctcctccaatggccggtggatgaggaaggtaa

DBGET integrated database retrieval system