KEGG   Rattus norvegicus (rat): 290553Help
Entry
290553            CDS       T01003                                 

Gene name
Mustn1, Mustang
Definition
(RefSeq) musculoskeletal, embryonic nuclear protein 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Mustang
Motif
Other DBs
NCBI-GeneID: 290553
NCBI-ProteinID: NP_852033
RGD: 727804
Ensembl: ENSRNOG00000017369
UniProt: Q80XX4 B0BMU8
Position
16p16
AA seq 82 aa AA seqDB search
MSEAGTPEAPIKKKRPPVKEEDLKGARGSLSKNQEIKSKTYQVMRDYEQAGSAAPSIFSR
NRTGTETVFEKPKEGPAKSVFG
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggctggcactcctgaagcccccatcaagaagaagcgcccccctgtgaaggaa
gaagacctgaagggggcccgggggagtctgtccaagaaccaggagatcaagtctaagacg
taccaggtcatgcgggactatgagcaagctggctcagctgccccatctatattcagccgc
aaccgcacgggcaccgagacagtcttcgagaagcccaaagagggacctgccaagagcgtc
tttggctga

DBGET integrated database retrieval system