KEGG   Rattus norvegicus (rat): 290641Help
Entry
290641            CDS       T01003                                 

Gene name
Rpl18a
Definition
(RefSeq) ribosomal protein L18A
  KO
K02882  large subunit ribosomal protein L18Ae
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    290641 (Rpl18a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    290641 (Rpl18a)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    290641 (Rpl18a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L18A
Motif
Other DBs
NCBI-GeneID: 290641
NCBI-ProteinID: NP_997675
RGD: 1302976
Ensembl: ENSRNOG00000018795
UniProt: P62718
Position
16p14
AA seq 176 aa AA seqDB search
MKASGTLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFWYFVSQLKKMKKSSGE
IVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAGAVTQCYRDMGARHRAR
AHSIQIMKVEEIAAGKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgtcgggcacgcttcgggagtacaaggtggtggggcgttgcttgccaacccca
aaatgccacacaccgccactgtaccgaatgcgaatctttgcacccaaccatgtggtggcc
aagtcccgcttctggtactttgtgtcgcagctgaagaagatgaagaagtcatccggggaa
attgtgtactgtgggcaggtgtttgagaagtcacccctgcgtgtgaagaacttcggcatc
tggctgcgctatgattcccgaagtggcactcacaacatgtaccgagagtaccgggacctg
accactgccggcgcggtcacacagtgctaccgagacatgggtgcccgacaccgtgcccgt
gcgcactccatccagatcatgaaggtggaagagattgcagctggcaagtgccgccggcca
gctgtcaagcagttccacgactccaagatcaagttcccattgccccaccgtgtgttgcgg
cgccagcacaaaccacgcttcaccaccaagaggccaaacaccttcttctag

DBGET integrated database retrieval system