KEGG   Rattus norvegicus (rat): 290644
Entry
290644            CDS       T01003                                 

Gene name
Ifi30
Definition
(RefSeq) gamma-interferon-inducible lysosomal thiol reductase precursor
  KO
K08059  interferon, gamma-inducible protein 30
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    290644 (Ifi30)
SSDB
Motif
Pfam: GILT
Other DBs
NCBI-GeneID: 290644
NCBI-ProteinID: NP_001025197
RGD: 1310758
Ensembl: ENSRNOG00000019387
UniProt: Q499T2
Position
16
AA seq 248 aa
MSCSPLVPFLSLLLLLFLPEVPRAATASLPQGSSEGAATCKAHDLCLFGPRRLLSAPPVN
VSLYYESLCGACRYFLVRNLFPTWLMVMEIMNITLVPYGNAQERNVSGTWEFTCQHGELE
CKLNKVEACLLDKLEKEAAFLTIVCMEEMEDMEKKLGPCLQLYVPEVSPESIMECATGKR
GTELMHENAQLTDALQPPHEYVPWVLVNEKPLTDPSQLLSSVCELYQGTEKPDICSSMAD
APREVCYK
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtcctgttctccgctcgtaccattcttgtcccttttgcttctgctgttcctacccgag
gttcccagagcagccactgcgtccctgccgcaaggatcctccgagggcgcagccacctgc
aaggcccacgacctgtgcctcttcgggccacgccggttgctctctgcaccacctgtcaat
gtcagcctctattatgagtccctgtgtggagcttgtcgctacttcctcgtccgaaatttg
ttcccaacctggctgatggttatggaaatcatgaacatcactctggtgccctacgggaac
gcacaggagagaaatgtcagcggtacatgggagttcacgtgccagcacggggagctggag
tgtaaactgaacaaggtggaggcctgtctgctggacaagctggaaaaggaggcggcattc
ctaaccatcgtctgtatggaggagatggaggacatggagaagaaactgggcccgtgcctg
cagctgtatgttccagaggtgtcaccagaaagcatcatggagtgtgccaccggaaaacga
ggcacagagctgatgcatgagaacgcccagctcacagatgccctacagccaccccatgag
tatgtgccctgggtcctggtcaacgagaaaccgttgacggaccccagccagctcctgagc
tccgtttgtgagctgtaccaggggacagagaagccagacatctgctcctccatggctgat
gcccccagggaggtctgctataagtga

DBGET integrated database retrieval system