KEGG   Rattus norvegicus (rat): 290646
Entry
290646            CDS       T01003                                 

Gene name
Pde4c, Dpde1
Definition
(RefSeq) phosphodiesterase 4C
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno04024  cAMP signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    290646 (Pde4c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    290646 (Pde4c)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    290646 (Pde4c)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    290646 (Pde4c)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     290646 (Pde4c)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR
Other DBs
NCBI-GeneID: 290646
NCBI-ProteinID: NP_001263694
RGD: 727918
Ensembl: ENSRNOG00000019518 ENSRNOG00000043249
UniProt: G3V8J8
Position
16p14
AA seq 671 aa
MRRSGTTLSFLLTERVREPVDSGVAPVSHLGGGVILRRFSGTLLLPPLSSRLGSSGEAES
AAPVVFTIGSRGTERSHGSAQSSFDLENGLPSGRGPLDAQSGSSLGRALQPPVHHGQRRE
SFLYRSDSDHEPSPKAVSRTSSAASDLHGEDMIVTPFAQVLASLRTVRSNVAALAHGAGS
ATRQALLGTPPQSSQQAAPAEESGLQLAQETLEELDWCLEQLETLQTRRSVGEMASNKFK
RMLNRELTHLSETSRSGNQVSEYISQTFLDQQAEVELPAPPTEDHPWPMAQITGLRKSCH
TSLPTAAIPRFGVQTDQEEQLAKELEDTNKWGFDVFKVAELSGNRPLTAVIFSVLQERDL
LKTFQIPADTLLRYLLTLEGHYHSNVAYHNSIHAADVVQSAHVLLGTPALEAVFTDLEVL
AAIFACAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQGENCDIFQN
LSTKQKLSLRRMVIDMVLATDMSKHMSLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQ
SLVHCADLSNPAKPLPLYRQWTERIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVG
FIDYIAHPLWETWADLVHPDAQELLDTLEDNREWYQSRVPCSPPHAIGPDRFKFELTLEE
TEEEEEEDERH
NT seq 2016 nt   +upstreamnt  +downstreamnt
atgaggcggagtggcacgaccctgtccttcctgttgactgagcgagtccgagagccagtg
gattctggagtggcccctgtcagccacctaggtgggggtgtgatcctgagacggttctca
gggaccctgctgctgcctccgctgtccagccgactcgggtcctctggggaggcggagtct
gctgcccccgtggttttcaccatcggatcccgagggacagagagaagccatggctcagct
cagagcagctttgacctggaaaatgggctcccgagcggcaggggtcccctggatgctcag
tccgggtcgagtctcggccgcgccctccaaccccctgtgcatcacggccagcggcgcgag
tccttcctgtaccgctcggacagtgaccatgagccttcacccaaggctgtgtcccggacc
tcctcggcggccagcgacctacatggagaagacatgattgtcacacccttcgcccaggtc
ctggccagtctcaggacggtccgtagcaacgtggctgcccttgcacatggcgcgggcagt
gccactaggcaggcgctcctggggacccctccgcagagcagccaacaggccgccccagca
gaggaatctgggctgcagctggcgcaggagacactggaggagctggactggtgcctggag
cagctggagacactgcagactcgtcgctcggtgggcgagatggcttctaacaagttcaag
cgcatgctcaaccgtgagttgacccacctgtcggaaaccagccgctcagggaaccaagtg
tcagagtacatctcgcagactttcctggaccagcaggctgaggtggagctgccggctccg
cccacggaagaccacccatggcccatggcccagatcactgggctgcggaagtcttgccac
accagccttcctacagctgccatcccgcgctttggggtccagacagaccaggaggagcag
ctggctaaggagcttgaagacaccaacaaatggggattcgatgtgtttaaagtggctgag
ctgagtgggaaccggcccctcactgctgttatcttcagcgttctccaggaacgggacctg
ctcaagacgttccagatcccggcggacacgctgctgaggtacctgctgaccctcgaaggg
cactaccactccaacgtggcgtaccacaacagcatacatgctgccgacgtggtgcaatcc
gcgcacgtgttgctgggcaccccagccctggaggctgtgttcacggacctagaagtcttg
gccgccatctttgcgtgcgctatacacgatgtagaccacccaggtgtctccaaccagttt
ctcatcaacaccaactcggagctggcactgatgtacaatgactcatcggtgctagagaac
catcacctcgcggtaggcttcaagctcctgcagggggaaaactgcgacatcttccagaac
ctcagcaccaagcagaaactgagtctgcgcaggatggtcatagacatggtactggccaca
gacatgtccaagcacatgagcctcctggctgacctcaagaccatggtggagaccaagaaa
gtgactagccttggcgtcctgctcttggacaactactctgaccgcatccaggtcctccag
agcctggtgcactgcgccgacctcagcaaccctgccaagccactacccctctaccgccag
tggacggagcgcatcatggctgagttcttccagcagggtgaccgggaacgtgagtcgggc
ttggacatcagccccatgtgcgacaagcacacagcctcggtggagaaatcccaggtggga
ttcattgactacatcgctcacccattgtgggaaacttgggccgacctggtgcaccccgat
gcccaggagctgctggataccttggaagacaacagagagtggtatcagagtagggttccc
tgcagccctccacacgccattggccctgacaggttcaagtttgagctgaccctggaggag
acagaggaagaggaggaagaggatgaaaggcactga

DBGET integrated database retrieval system