KEGG   Rattus norvegicus (rat): 290658
Entry
290658            CDS       T01003                                 

Gene name
Cers1
Definition
(RefSeq) ceramide synthase 1
  KO
K04710  sphingoid base N-stearoyltransferase [EC:2.3.1.299]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00094  Ceramide biosynthesis
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    290658 (Cers1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    290658 (Cers1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.299  sphingoid base N-stearoyltransferase
     290658 (Cers1)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Other DBs
NCBI-GeneID: 290658
NCBI-ProteinID: NP_001037695
RGD: 1305974
Ensembl: ENSRNOG00000062030
Vega: OTTRNOG00000001983
UniProt: Q1HL14
Position
16
AA seq 350 aa
MAAAATTTGLEAPEPMPSYAEMLQRSWASALAAARGCGDCGWGLARRGLAEHAHLAAPEL
LLAVLCALGWTALRSAATTRIFRPLAKRCRLQPRDAARLPESAWKLLFYLACWSYCAYLL
LGTSYPFFHDPPSVFYGWRSGMAVPWDIAVAYLLQGSFYCHSVYATVYMDSWRKDSVVML
VHHVVTLLLIASSYAFRYHNVGLLVFFLHDVSDVQLEFTKLNIYFKARGGAYHRLHGLVA
NLGCLSFCFCWFWFRLYWFPLKVLYATWHCSLQSVPDIPYYFFFNTLLLLLLVMNIYWFL
YIVAFAAKVLTGQMRELEDLREYDSLEAQTAKPCRAEKPLRNGLVKDKLF
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggctgctgcagcgacgaccaccgggctcgaggcgccagagcccatgccgagttatgca
gagatgttgcaacgaagctgggcctcggcgctggccgcagcacggggctgcggggactgc
ggctggggactggcgcgccgcggcctggcggagcacgctcatctggctgcacccgagctg
ctgctggccgtgctctgcgctctggggtggacagcgttgcgctcagcagccaccacgcgc
atctttcggcccctggccaagcggtgtcgcctgcagcctagagacgcggctaggctgcct
gagagtgcctggaagcttctgttctacttggcctgttggagctactgtgcctacctgctc
ttgggcaccagttaccctttcttccatgacccgccctctgtcttctacggctggaggtcg
ggcatggcggtgccctgggacatagcggtcgcctacctgctgcaggggagtttctactgt
cattccgtctatgccaccgtgtacatggacagctggcgcaaggactcggtggtcatgctg
gtacaccatgtggtcaccttactgctcatcgcctcttcctatgcgttccgataccacaac
gtgggcctcctcgtgttcttcctgcatgacgtcagcgatgtgcagctggagttcaccaag
ctcaacatctacttcaaggccaggggtggcgcctaccatcgattgcacgggctggtggcc
aacctgggctgcctcagcttctgcttctgctggttctggttccgcctctactggttccca
ctcaaggttctctatgccacctggcactgcagcctgcagtctgtgcctgacattccgtac
tatttcttcttcaacactctgctgctgctcctcctggtcatgaacatctactggttcctg
tacattgtggcttttgcagccaaggtgctgaccggtcagatgcgtgaactggaagacttg
cgggaatacgacagtctggaagcgcagacagccaagccctgcagagctgagaagcctcta
aggaatggcctggtgaaggacaaactcttctga

KEGG   Rattus norvegicus (rat): 304208
Entry
304208            CDS       T01003                                 

Gene name
Cers4
Definition
(RefSeq) ceramide synthase 4
  KO
K24621  very-long-chain ceramide synthase [EC:2.3.1.297]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00094  Ceramide biosynthesis
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    304208 (Cers4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    304208 (Cers4)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.297  very-long-chain ceramide synthase
     304208 (Cers4)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain
Other DBs
NCBI-GeneID: 304208
NCBI-ProteinID: NP_001100587
RGD: 1309303
Ensembl: ENSRNOG00000001072
UniProt: D3ZU86
Position
12
AA seq 393 aa
MLFSLNEWLWQETYWLPPNVTWAQLEDRDGLVFAHPHHVLAALPIALVLVAMRIIFERFV
ALPLSRWMGVQDPIRRKIKPNPVLEKYFLRMKQRPVETQMVLLASQCGLTLRQIQRWFRR
RRNQDRPCLSKKFCEASWRFVFYLCSFVGGTSILYHESWLWTPALCWENYPHQTLNLALS
WWYLLELGFYISLLITLPFDIKRKDFKEQVAHHFVTVGLIVFSYSVNLLRIGSVVLLLHD
CSDYLLEGCKMLNYAHFQRGCDTLFIIFSLVFFYTRLVFFPTEVIYTAVFDSIKNSGPFF
GYYFFIVLLGMLQILHVYWFCLILRMICSFLRKGQMREDIRSDVEESDSSDDEAVSEGPQ
LKNGMARGSRAAITNGPRSRAAACLTNGHTRAT
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgctgttcagcttgaatgagtggctgtggcaggagacatactggttaccacccaatgtc
acatgggcacagctggaggaccgtgatggcctggtgttcgcccaccctcaccacgtgctt
gctgccttgccaattgcactggtcctggtggctatgcgtatcatctttgagagattcgtg
gccttgcccctgagccggtggatgggtgtgcaggatccaatcaggagaaagataaagccc
aacccagtgctggagaaatacttcctcaggatgaagcagagaccagtggagacccagatg
gtcctcctggcttcccagtgtggcctcacgttgcggcagattcaacgctggttcaggaga
cgtcggaaccaggatcggccttgcctgtccaagaaattctgtgaagccagctggaggttt
gtcttctatctgtgttccttcgtgggtggcacctctatcctctaccatgagtcatggttg
tggacaccggcattgtgctgggagaattacccacatcagaccctgaatttggccctgtcc
tggtggtacctcctggagctgggcttctacatttcactgctaatcactctgccctttgac
atcaaacgcaaggacttcaaggagcaggtggcgcaccacttcgtgaccgtgggactgatc
gtcttctcctacagcgtcaacctcctccgcattggctctgtggtactgttgttgcatgac
tgctccgactacctgctggagggctgtaagatgctcaactatgcccactttcagcgaggg
tgcgatactcttttcatcatcttctccttagtcttcttctacacacgcctcgtattcttc
cccaccgaggtcatctacactgctgtgtttgactcaatcaagaactcaggccccttcttt
ggctactacttctttattgtgctcctggggatgctacagattcttcatgtgtactggttc
tgcctcatcctgcgcatgatctgcagtttcctgaggaagggtcagatgagagaggacatt
cgtagtgatgtggaagaatcagactccagtgatgacgaggcagtttctgaaggtccccag
ctgaagaatgggatggctcgagggtctagagcagccattaccaatggcccgcggagccgg
gcagcagcttgcctgaccaatgggcacacccgggccacatag

KEGG   Rattus norvegicus (rat): 310667
Entry
310667            CDS       T01003                                 

Gene name
Cers2
Definition
(RefSeq) ceramide synthase 2
  KO
K24621  very-long-chain ceramide synthase [EC:2.3.1.297]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00094  Ceramide biosynthesis
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    310667 (Cers2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    310667 (Cers2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.297  very-long-chain ceramide synthase
     310667 (Cers2)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain Homez
Other DBs
NCBI-GeneID: 310667
NCBI-ProteinID: NP_001028872
RGD: 1310059
Ensembl: ENSRNOG00000021138
UniProt: G3V8V4 Q3T1K1
Position
2
AA seq 380 aa
MLQTLYDYFWWERLWLPVNLTWADLEDKDGRVYAKASDLYITLPLALLFLIIRYFFELYV
ATPLAALLNVKEKTRLRAPPNATLEHFYLTVGKQPKQVEVDLLSRQSGLSGRQVERWFRR
RRNQDRPSLLKKFREASWRFTYYLIAFVAGMAVTVDKPWFYDLRKVWEGYPIQSIIPSQY
WYYMIELAFYWSLLFSIASDVKRKDFKEQIIHHVATIILLCFSWFANYVRAGTLIMALHD
SSDYLLESAKMFNYAGWKNTCNNLFIVFAVVFIITRLVIMPFWILHCTMIYPLEFYPAFF
GYYFFNSMMVVLQMLHVFWAYFIVRMAHKFITGKLVEDERSDREETESSEGEEAAAGAGA
KSRLLANGHPILNNNHPKND
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgctccagaccttgtatgactacttctggtgggaacgactatggctgcctgtgaactta
acctgggctgatctagaagacaaagatggacgtgtctatgccaaagcctcagacctctac
atcacactacccctggccctgctctttctcatcattcgatacttctttgagctttatgtg
gctacacccctggctgccctcctgaatgttaaggagaaaacccgactgcgggcacctccc
aatgccaccttagagcatttctacctgaccgtcggcaagcagcccaagcaggtggaggta
gaccttttgtctcggcagagtgggctctctggacgccaggtagaacgttggttccgccgc
cgccgcaaccaggacaggcccagtcttctcaagaagttccgagaagccagctggagattc
acatattacctcattgcctttgttgctggcatggctgtcactgtggataaaccctggttc
tatgacttgaggaaagtttgggaaggatatcccatacagagtatcatcccttctcagtat
tggtactacatgattgagcttgctttctactggtccctgctcttcagcattgcctccgat
gtcaagcgaaaggattttaaggaacagatcatccaccatgtggccaccatcattctcctc
tgcttctcctggtttgccaattatgtccgagcagggaccctcatcatggctctgcatgac
tcttccgactacctgctggagtctgccaagatgtttaactacgcaggatggaaaaacacc
tgcaacaacctcttcattgtcttcgccgtcgttttcatcatcactcgactggttatcatg
cccttctggatcctccactgcacaatgatatacccactggagttctaccctgccttcttt
ggctattacttcttcaattccatgatggtagtgctacagatgctccatgtcttctgggcc
tacttcattgtgcgcatggcccacaagttcataactggaaagctggtagaagatgaacgc
agtgacagagaagaaacagagagttcagagggggaggaggctgcagctggggcaggagca
aagagccgactcctagctaatggccaccccatcctcaataacaaccatcctaagaatgac
tga

KEGG   Rattus norvegicus (rat): 366065
Entry
366065            CDS       T01003                                 

Gene name
Cers6
Definition
(RefSeq) ceramide synthase 6 isoform X1
  KO
K23727  sphingoid base N-palmitoyltransferase [EC:2.3.1.291]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00094  Ceramide biosynthesis
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    366065 (Cers6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    366065 (Cers6)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.291  sphingoid base N-palmitoyltransferase
     366065 (Cers6)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain DUF5931
Other DBs
NCBI-GeneID: 366065
NCBI-ProteinID: XP_006234370
RGD: 1561599
Ensembl: ENSRNOG00000024595
UniProt: F1LTP8
Position
3
AA seq 392 aa
MAGILAWFWNERFWLPHNVTWADLKNTEEATFPQAEDLYLAFPLAFCIFMVRLIFERFIA
KPCAVALNIQANGPQIAQPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQR
RNQEKPSTLTRFCESMWRFSFYLYVFSYGVRFLKQTPWLWNTRHCWYNYPYQPLTADLHY
YYILELSFYWSLMVSQFTDIKRKDFGIMFLHHLATIFLITFSYVNNMARVGTLVLCLHDS
ADALLEAAKMANYAKFQKMCDLLFVMFAVVFITTRLGIFPLWVLNTTLFESWEIVGPYPS
WWVFNLLLLLLQGLNCFWSYLIVKIACKTVSKGKAGKWNPVHVSKDDRSDIESSSDDEDS
EPPGKKLHSSTTTNGTSGTNGYLLTGPCSMDD
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggcagggatcttagcctggttctggaatgagcggttttggcttccgcacaatgtcacc
tgggcagacctgaagaacacggaggaagccaccttcccgcaggcggaggacctctacctc
gccttccccttggccttctgcatcttcatggtgcggctcatcttcgagagattcatagcc
aaaccatgtgccgtagccctcaacatccaagccaatggaccacaaattgcccagccaaat
gccattctggaaaaggttttcaccgccataacaaagcatcctgatgagaagagattggaa
gggctctccaagcagctggactgggatgttcggagcattcaacgctggtttcgacaaagg
cgtaaccaggagaaacccagcactctgaccaggttctgcgagagcatgtggagattttcc
ttttacctctatgtatttagctacggagtccggttcttgaaacagaccccttggttgtgg
aatacaaggcactgctggtataactacccttaccagccactcactgctgacctccactac
tattacatcctggagctgtcgttttattggtctttaatggtttcccagttcacagatatc
aaaaggaaggacttcggcattatgttcctgcaccaccttgcaaccattttcttaataact
ttttcatatgtcaacaacatggcccgagtaggaaccctggtcctctgtcttcacgactca
gccgatgctctgctagaggctgccaaaatggcaaattatgccaaatttcagaaaatgtgt
gatctcctgtttgtcatgtttgctgtggtttttatcaccacacggctgggcatatttcct
ctctgggtgttgaataccacattatttgaaagttgggagatcgttggaccgtacccatcc
tggtgggtttttaacctgctgctgttgttactacaagggttgaactgcttctggtcttac
ctgattgtaaaaatagcttgcaaaactgtttcaaaaggcaaggccgggaagtggaaccct
gtacatgtgtccaaggacgaccggagcgacattgaatctagctcagatgatgaggactcg
gagcctccaggaaagaaactacactcttcgacaaccaccaacggaaccagcggtaccaac
gggtacctcctcactggcccttgctccatggatgattaa

KEGG   Rattus norvegicus (rat): 366984
Entry
366984            CDS       T01003                                 

Gene name
Cers5
Definition
(RefSeq) ceramide synthase 5
  KO
K23727  sphingoid base N-palmitoyltransferase [EC:2.3.1.291]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00094  Ceramide biosynthesis
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    366984 (Cers5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    366984 (Cers5)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.291  sphingoid base N-palmitoyltransferase
     366984 (Cers5)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain
Other DBs
NCBI-GeneID: 366984
NCBI-ProteinID: NP_001102463
RGD: 1311597
Ensembl: ENSRNOG00000052990
UniProt: D4AA91
Position
7
AA seq 449 aa
MATAAAEALGLLWGWLWSGRFWLPQNVSWADLEGPGDGYGYPRARHVLSVFPLAAGLFSV
RMLFERFIAKPCALRIGIEDSAVYQVESNVTLEKVFTSISKYPDEKRLKGLSKQLDWDVR
KIQCWFRHRRNQDKPPTLTKFCESMWRFTFYFCIFCYGVRFLWSMPWLWDTRQCWYNYPY
QPLSRELYYYYLTQLAFYWSLVFSQFIDVKRKDFLMMFMHHLIAVTLISFSYINNMVRVG
AIILCLHDSADSLLEAAKLANYARQERLCNTLFVIFGAAFMVTRLGIFPLWILNTTLFES
WEIIGPFPSWWLFNGLLLILQMLHVIWSYLIARTAFKALVRGKVTYPGGISPGSVPSALF
SPPSSFLCLVAAGQSHPLHVSKDDRSDVESSSEEDETTHTNNLSGSSSSNGANCMNGRMG
GSHLAEEQGTCKAAGNLHFGASPRIHSCD
NT seq 1350 nt   +upstreamnt  +downstreamnt
atggcgactgcggcggcggaagccctgggcctcctgtggggctggctgtggagcgggcgc
ttctggctgcctcagaacgtgagctgggcggacctggagggcccgggcgacggctacggc
tacccgcgcgcccggcacgtgctgtcggtgttcccgctggcagcaggtctcttctccgtg
aggatgctgttcgagcgatttattgctaaaccctgtgcactccgtattggcattgaagac
agtgctgtctaccaggtggaatccaatgtcacccttgagaaggtgttcacatctatctct
aagtatcctgatgagaaaaggctgaagggcctatcaaagcaactggactgggatgttcga
aaaatccaatgctggtttcgccatcggagaaatcaggacaagcctccaacgctcactaag
ttctgtgagagcatgtggagattcactttctatttttgtatcttctgctacggagtcaga
tttctctggtcgatgccttggctctgggatacccgacagtgctggtacaactatccatat
cagccactctcaagagagctctattactactatctcacacagctggccttctactggtcc
ctcgtgttctctcagtttatagatgttaaaagaaaggacttcctgatgatgtttatgcat
catttgatcgccgtcacgctcatcagtttctcctacatcaacaacatggtgcgagtggga
gccatcatcttgtgtctgcatgactccgccgactccttgctagaagctgccaagctggcc
aattacgccagacaggagcggctctgtaacaccctctttgtgatctttggtgcagctttt
atggttactcgtctagggatcttccctttgtggattctgaacacaaccctctttgagagc
tgggagattattgggccctttccttcctggtggctcttcaatggcctcctcctgatccta
cagatgttgcatgtcatctggtcctacctaatcgcacgaactgcttttaaagccttggtc
cggggcaaggtgacctacccaggagggattagccccggctctgtaccctctgctcttttc
tcacctccttcctcttttctatgcctggtggcagctggacagtcccatcctctgcatgtg
tctaaggatgaccgcagtgatgtagaaagcagctcagaggaagatgagaccacacacacg
aacaacctctctggcagcagttccagcaacggtgccaactgcatgaacggccgcatggga
ggcagccacttggctgaggagcaggggacttgtaaagctgctggcaacctacactttggg
gcctccccacgtatacactcctgtgactag

KEGG   Rattus norvegicus (rat): 499174
Entry
499174            CDS       T01003                                 

Gene name
Cers3
Definition
(RefSeq) ceramide synthase 3
  KO
K24622  very-long-chain ceramide synthase / ultra-long-chain ceramide synthase [EC:2.3.1.297 2.3.1.298]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00094  Ceramide biosynthesis
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    499174 (Cers3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    499174 (Cers3)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.297  very-long-chain ceramide synthase
     499174 (Cers3)
    2.3.1.298  ultra-long-chain ceramide synthase
     499174 (Cers3)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain FAM176 TRAP_alpha BSP_II Homez CobT DUF1003
Other DBs
NCBI-GeneID: 499174
NCBI-ProteinID: NP_001121033
RGD: 1564356
Ensembl: ENSRNOG00000013823
UniProt: B1H294
Position
1
AA seq 391 aa
MFYRFRKWFWSERFWLPPTIKWSDLEDHEGLVFVKASHLYITIPYALLLLVVRYFFEKFV
ATPLANALGIQKAQHKIKPNAILENFFQHSTSQPSHNEVYGLAKKCNLTERQVERWFRIR
QKQNKPCRLQKFQESCWRFTFYFMMTVAGAVFLYDKPWAYDLWEVWYDYPRQPLLPSQYW
YYVLEMSFYWSLVFSLGSDIKRKDFLANVIHHLAAISLMSFSWCANYIRSGTLVMFVHDI
SDIWLESAKMFSYAGWKQTCNTLFFIFAIVFFISRFIIFPFWILYCTLILPLHYLEPFFS
YIFLNLQLMILQGLHIYWGYLILKMLNRCIFTQNIQDVRSDNEEEEDEEEEEEEEEEEEE
EEENTKGKETEYLKNGLGTNRHLIPNGQHGR
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgttttacaggtttagaaaatggttctggtcggagagattctggcttcctccgacaata
aagtggtcagacctggaagatcatgaaggactggtctttgtgaaagcgtcccacttgtat
atcacaattccgtatgcccttctcttactggtcgtcagatacttctttgaaaagtttgtt
gccacacctctagccaatgcacttggcattcaaaaggcacagcataaaattaaaccaaat
gccatcttagagaattttttccagcattccacaagtcaaccgtcacataatgaagtttac
ggactggcaaagaagtgtaacttgacagagcgccaggttgaaagatggtttagaattcgc
cagaagcaaaacaaaccttgcaggttgcagaaattccaagaatcttgctggcgatttaca
ttctatttcatgatgacggtggctggagctgtgtttctgtatgataaaccatgggcatac
gacctctgggaggtttggtatgattatcccagacagcctttgctgccctcccagtactgg
tactacgttttggagatgagtttttattggtcactggtgtttagcctgggctctgatatc
aagaggaaggatttcctcgctaatgtcatccaccacctggctgctattagtctgatgagc
ttctcctggtgtgctaattacattcgcagtgggaccctcgtgatgtttgttcatgatata
tctgacatttggctagagtctgctaagatgttttcctatgctggatggaagcaaacctgt
aataccctgttcttcatcttcgccatcgtgttcttcattagccgattcattatatttccg
ttctggattctgtactgcaccctgatcctgcctttgcactatctcgagcccttcttctcc
tacatcttcctcaacctccagctcatgatccttcagggccttcacatttactggggttac
ttaatcctgaagatgctcaacagatgcatattcacacagaacatccaggatgtgaggagt
gacaacgaagaggaagaagatgaggaggaggaagaggaggaagaagaagaggaagaagag
gaggaggagaacaccaaaggcaaagagacagagtatttgaagaatggccttgggaccaac
aggcatctcattcccaatggtcagcatggccgttag

DBGET integrated database retrieval system