KEGG   Rattus norvegicus (rat): 290673
Entry
290673            CDS       T01003                                 

Gene name
Atp13a1, Atp13a
Definition
(RefSeq) ATPase 13A1
  KO
K14950  manganese-transporting P-type ATPase [EC:7.2.2.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    290673 (Atp13a1)
SSDB
Motif
Pfam: E1-E2_ATPase Hydrolase Cation_ATPase Hydrolase_3
Other DBs
NCBI-GeneID: 290673
NCBI-ProteinID: NP_001099549
RGD: 1306033
Ensembl: ENSRNOG00000010776
UniProt: G3V7I3
Position
16p14
AA seq 1197 aa
MAVVGNAVPCGARPGGARGSGSPQPGRPGLAAGPALIASGDELVAAVWPYRRLALLRRLT
VLPFAGLLYPAWLGAAASGCWGWGNSWTQIPEAALLALATICLAHALTILSGHWSVHAHC
ALTCTPEHDPNKVTFVKVVPTPNNGSTELVALHRDKGEDGLEVLSFEFQKIKYSYDALEK
KQFLPVAFPVGNAFSYYQSNRGFQEDSDIRAAEKKFGSNKAEMAVPDFSELFKERATAPF
FVFQVFCVGLWCLDEYWYYSVFTLSMLVAFEASLVQQQMRNMSEIRKMGNKPHMIQVYRS
RKWRPIASDDIVPGDIVSIGRSPQENLVPCDVLLLRGRCIVDEAMLTGESVPQMKEPIED
LSPDRVLDLQADARLHVIFGGTKVVQHIPPQKATSGLKPVDNGCVAFVLRTGFNTSQGKL
LRTILFGVKRVTANNLETFIFILFLLVFAIAAAAYVWIEGTKDPSRNRYKLFLECTLILT
SVVPPELPIELSLAVNTSLIALAKLYMYCTEPFRIPFAGKVEVCCFDKTGTLTSDSLVVR
GVAGLRDGKEVTPVSSIPIETHRALASCHSLMQLDDGTLVGDPLEKAMLTAVDWTLTKDE
KVFPRSIKTQGLKIHQRFHFASALKRMSVLASYEKLGSTDLCYIAAVKGAPETLHSMFSQ
CPPDYHHIHTEISREGARVLALGYKELGHLTHQQAREVKREALECSLKFVGFIVVSCPLK
ADSKAVIREIQNASHRVVMITGDNPLTACHVAQELHFIDKAHTLILHPPSEKGQPCEWRS
IDNSIVLPLTLGSPKALALEHALCLTGDGLAHLQAVDPQQLLHLIPHVQVFARVAPKQKE
FVITSLKELGYVTLMCGDGTNDVGALKHADVGVALLANAPERVVERRRRPRDSPVLSNSG
PRVSRSTKQKSALLSPEEPPASHRDRLSQVLRDLEDESTPIVKLGDASIAAPFTSKLSSI
QCICHVIKQGRCTLVTTLQMFKILALNALILAYSQSVLYLEGVKFSDFQATLQGLLLAGC
FLFISRSKPLKTLSRERPLPNIFNLYTILTVMLQFSVHFLSLVYLYREAQARSPEKQEQF
VDLYKEFEPSLVNSTVYIMAMAMQMATFAINYKGPPFMESLPENKPLVWSLAVSLMAIMG
LLLGSSPDFNSQFGLVDIPVEFKLVIGQVLALDFGLALLADRVLQFFLGTPKLRVPS
NT seq 3594 nt   +upstreamnt  +downstreamnt
atggcggtggtgggcaacgcggtaccttgcggagcccggcctggcggggcccggggcagc
gggtctcctcagcctgggcggccgggcctcgctgccgggccagcgctcatagcgagcggc
gacgaactggtggccgctgtatggccataccggcggctggcgcttctgcggcgcctcacc
gtgctgccgtttgccgggttgctgtacccagcctggctgggcgccgccgccagcggttgc
tggggatggggcaacagctggacccagataccggaggccgcactgctggccctcgctacc
atctgcctcgcgcacgcactcacaatcctgtcggggcattggtctgtgcacgcgcactgc
gcgctcacctgcaccccggagcatgatcccaacaaagtaaccttcgtgaaggtggtgcca
acccccaacaatggctccactgaactggtggccctgcaccgtgacaagggagaagatggg
ctggaggtgctgtcatttgagttccagaagatcaaatattcctatgatgccctggagaaa
aagcagttcctcccggtggccttcccagtggggaacgccttctcttactatcaaagcaac
agaggtttccaggaagactccgacatccgagccgcagagaagaagtttgggagcaacaag
gccgagatggcggtgcctgacttctctgagcttttcaaggagagagccacagcccctttc
ttcgtgtttcaggtgttctgcgtcgggctctggtgcctggacgagtactggtactacagt
gtcttcactctgtccatgctggtggctttcgaggcttccctagtgcagcagcagatgagg
aacatgtcagagatccgaaagatgggcaacaaaccccacatgattcaggtctaccgaagc
cgaaagtggaggcccatcgccagcgatgacattgttcctggggacatcgtgtccatcggc
cgctccccccaggagaacctggtgccgtgtgatgtactgctgctgcggggccgctgcatt
gtggatgaggccatgctcactggggaatctgtgccacaaatgaaggagcccattgaagac
ttgagcccagaccgtgttctagacctgcaggccgacgctcggctgcatgtcatctttggg
ggcaccaaggtggtacagcacatccccccacagaaggccacttcgggcctgaagccggtt
gacaacggatgtgtggcctttgtcctaaggactggattcaacacatcccagggcaagcta
ctacgtacaattctctttggggtaaagagggtcactgcaaacaacctggagaccttcatc
ttcatcctcttcctcctggtgttcgccattgctgcagccgcgtatgtgtggattgaaggg
accaaggaccccagccggaaccgttacaagctttttctggagtgcaccctcatcctcacc
tcggtcgtaccccctgaactgcccattgagctgtccctggctgtgaacacctccctcatc
gccctggccaagctctacatgtactgcacagagcctttccggatccccttcgctggcaag
gtcgaagtatgttgctttgacaagacgggtaccttgactagtgacagcctggtggtgcga
ggcgtggcagggctgagagatgggaaagaggtgaccccagtgtccagcattcccatagaa
acacaccgggccctggcttcctgccactccctcatgcagctggatgatggcaccctagtg
ggtgaccctctggaaaaggccatgctgacagctgtagactggacactaaccaaagatgag
aaagtattcccccgaagtattaaaactcaggggctgaaaattcaccagcgctttcatttt
gccagtgccctaaagcgaatgtctgtgctcgcctcctacgagaagctcggctccactgac
ctctgctacatcgcggctgtgaagggggcccccgaaaccctgcactctatgttttcccag
tgcccacctgactaccaccacatccacactgagatctctcgggaaggagcccgtgtcctg
gctctgggctacaaggagctagggcatctcacgcatcagcaggcccgggaggtcaagcgg
gaggcactggaatgcagcctcaagtttgtgggcttcatcgtggtctcctgtccgctcaaa
gctgactcaaaggctgtgatccgagagatccagaatgcatcccaccgggttgtcatgatc
acaggagacaacccactcactgcatgccatgtagctcaggaactgcatttcattgacaag
gcccatacgctcatcttgcatcctccctcggagaaaggccagccatgtgagtggcgctcc
attgataacagcatcgtactgcctctgaccctgggctcccccaaggccctggccctggag
cacgcgctgtgcctcacaggtgatggcttggctcacctgcaggctgtggatccccagcag
ctgctccacctcatccctcatgtgcaagtgtttgcccgtgtggcccccaagcagaaggaa
ttcgtcatcaccagcctgaaggaactgggttatgtgacccttatgtgtggagatggcacc
aatgatgtgggcgcactaaagcacgctgatgtgggtgtcgcgcttctggccaatgcccct
gagagggttgtagaacggcgacgacggccaagggacagccctgtcctgagtaacagtggc
cccagagtctccaggtcaaccaaacagaagtcggcactcctctctcctgaggagccacca
gcctcccacagggaccgcctgagccaggtgctacgggacctggaggatgagagcacccct
attgtgaagctgggggatgccagcattgcagcacccttcacctccaagctttcctccatc
cagtgcatctgccacgtgatcaagcagggccgttgcacattggtgacaacgctgcagatg
ttcaagatcctggccctcaatgccctcatcttggcatacagccaaagtgtcctctacctg
gagggtgtcaagttcagcgacttccaggccaccctgcaggggctgctgctggccggctgc
ttcctctttatttcccgctccaagcctctcaagactctttcccgagagcggcccctgccc
aacatcttcaacctatacaccatccttacggtgatgctgcagttctctgtccacttcctg
agcctggtctacctgtaccgggaggcccaggcacgcagccctgagaagcaggaacagttt
gtagacctgtacaaggagtttgagccgagcctggtcaacagcactgtgtacatcatggcc
atggccatgcagatggctacctttgccatcaactacaagggcccacccttcatggagagc
ctgcctgagaacaagcccttggtgtggagtctggcagtgtcactgatggccatcatgggc
ttgctcctgggctcctcccctgacttcaacagccagtttggcctcgtggacatccctgta
gagttcaagctggtcatcggccaggtcctggccctggacttcggcctggcactcctggct
gaccgtgtcctacagttctttttggggactccgaagctgagagtgccctcctga

DBGET integrated database retrieval system