KEGG   Rattus norvegicus (rat): 290686Help
Entry
290686            CDS       T01003                                 

Gene name
Tma16, RGD1305222
Definition
(RefSeq) translation machinery associated 16 homolog
  KO
K14860  translation machinery-associated protein 16
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    290686 (Tma16)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic Type
  Pre-60S particles
   Other pre-60S particles
    290686 (Tma16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tma16 UCH DUF1910
Motif
Other DBs
NCBI-GeneID: 290686
NCBI-ProteinID: NP_001162573
RGD: 1305222
Ensembl: ENSRNOG00000014188
UniProt: D4AAG0
Position
16p14
AA seq 221 aa AA seqDB search
MPKGLKAKMVGREKKVIHPYSRKAAQITRESHKQDKKERLKTERALRLNLIGDKLQWFHS
HLDTKKSRYSKKDACELIERYLDRFSSELEQIELHNSIKDRQGRRHHSREAVIKQTMERE
RQQYEGYGFEIPDIVDSNALNTFREWDFDLKKLPNIKMRKLCANDAVPKKRKQKNILNIE
KDLGELDLTGETGDATDGKLEPASESSDTDEEMTAVPDSPH
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaggactgaaagcaaaaatggtaggacgggaaaaaaaagtcatccatccgtac
agtagaaaagcagctcagattacaagggagtctcacaaacaagacaagaaggaaagattg
aagacggagagggccttgcgtctcaaccttattggtgacaaacttcagtggtttcacagt
catctggatacaaaaaaatcgagatattcaaagaaagatgcctgtgaattaattgaaagg
tacttggatcggttcagcagtgagctggagcagattgagttacacaacagcatcaaggac
agacaggggaggcggcaccattcccgggaggctgtcatcaagcagaccatggagcgggag
cggcagcagtatgaaggctacggctttgagatcccagacatcgtagactctaatgctctg
aacactttccgggaatgggattttgatctgaagaaattgccaaacatcaaaatgaggaaa
ctgtgtgctaatgatgcggttcctaagaagcgcaaacagaaaaatattttaaatatagaa
aaggatttaggagaattagacctaacaggggaaactggagatgctacagatggaaaactg
gaaccagcaagtgaatcaagtgacacggatgaagaaatgactgcagtgcctgacagccct
cattga

DBGET integrated database retrieval system