KEGG   Rattus norvegicus (rat): 290746Help
Entry
290746            CDS       T01003                                 

Gene name
Trappc11, RGD1309765
Definition
(RefSeq) trafficking protein particle complex 11
  KO
K20308  trafficking protein particle complex subunit 11
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    290746 (Trappc11)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Tethering complex
   TRAPP complex II
    290746 (Trappc11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Foie-gras_1 Gryzun-like Gryzun DUF974 Prefoldin
Motif
Other DBs
NCBI-GeneID: 290746
NCBI-ProteinID: NP_001162586
RGD: 1309765
Ensembl: ENSRNOG00000022482
UniProt: D3ZHI8
Position
16q11
AA seq 1133 aa AA seqDB search
MSPTQWDFPVELCCRPMAFVTLTGLDVVYNAVHRAVWDAFCANRRADRVPISFKVLPGDH
EYPKCRSKRTSYEWYIPKGILKTGWMNKHLNLVPALVVVFYELDWDEPQWKEKQSECATR
VEIVRQSLQGRNTKVAVVLIQKKTPLPPGEDIIASERAAALCNVCELSGKSLFVLPHTDH
LVGYIIRLENAFYEHAQTYYYTEIRRVKSHKEFLNKTTHQLLFVRHQFKIAFFSELKQDT
QNALKNYRTAYNLVHELRAHETNILEIKTMAGFINYKICRLCFQHNTPLDAIAQFRKHID
LCKKKIGSAELSFEHAAWMSKQFQAFGDLFDEAIKLGLTAIQTQNPGFYYQQAAYYAQER
KQHAKALCNHDAAVVYPSPDPLETPTGVLDFYGQRPWRQGILSFDLSDPEKEKAGILAIQ
LKERSVVHSEMIITLLSNAVAQFKKYKCPRMKSHLMVQMGEEYYYAKDYTKALKLLDYVM
CDYRSEAWWTLLTSILTTALKCSYLMAQLKDYITYSLELLGRASTLKDDQKSRIEKNLMN
VLMNESPDPEPDCDALAVKTAQKLWADRVSLAGSNVFTIGVQDFVPFVQCKAKFHAPSFH
VDVPVQFDVYLKADCPHPIRFSKLCVSFNNQGYNQFCVLEEASKASEVLENLTQGKMCLV
PGKTRKLLFKFVAKTEDVGKKIEITSVDLFLGSESGRCVVLSWQGGGGDAASSQEALQAA
RSFKRRPKLPDDEVHWDSIIVQASTMIISRVPNISVHLRHEPPALMNEMYCLVVTVQSQE
KSQIRDVKLTAGLKPGQDANLTQKTHVTLHGAELCDESYPALLTDIPVGDLNPGEQLEKT
VYVRCGTVGSRMFLVYVSYLINTTVEGKGIMCKCHKDETVTIETVFPFDVAVRFVSTKFE
HLERVYADIPFLLMTDILSASPWALTIVSSELQLAPSMAAMDHLESQIDKVVLQTGESAS
ECFCLRCPSAGNLEGGVATGHYIISWKRSSGMENIPAISTIITLPHVIVENIPLHVNADL
PSFGRVRESLPVRYHLQNKTDLVQDVEISVEPSDAFMFSGLKQIRLRILPGTKQEMLYNF
YPLMAGYQQLPSLNINLLRFPNFTNQLLRRFIPTSIFVKPQGRLLEDTSIAAA
NT seq 3402 nt NT seq  +upstreamnt  +downstreamnt
atgagccccacacagtgggacttccctgtggagttatgttgccggcctatggcttttgtt
acacttactggccttgatgtggtgtataatgctgtccatcgagcagtctgggatgctttc
tgtgccaatcggagagctgaccgggtaccaatttctttcaaagtgctcccaggtgaccat
gaatacccaaaatgtagatcaaagagaacttcgtatgagtggtacattcctaaaggaatc
ctaaagaccggctggatgaataagcatctgaacctcgtgccagcgctggtggtcgtgttc
tatgaactggactgggacgagcctcagtggaaggaaaagcaatctgagtgtgccaccagg
gtggagattgtcaggcaaagtttgcaagggagaaacacaaaagttgcagtcgtcctgatt
caaaagaaaacacctttacccccaggggaagatatcattgcttctgagcgggctgcagct
ttatgcaatgtgtgtgagctctcaggcaagtctctgttcgtgctgccccacactgaccac
cttgtgggctacattataagattagaaaatgcattttatgagcatgcccagacctattac
tacactgagatcagaagagtgaaatctcataaggaattcttgaataaaacaacacaccag
cttttgtttgttagacatcagttcaaaatagctttcttcagtgagttgaaacaagataca
caaaacgccctgaagaattacaggactgcctataacctcgtacatgaactgagggcccat
gaaactaatattctggaaattaagacgatggcaggatttataaactacaagatctgtagg
ctgtgttttcaacacaataccccactagatgccattgctcagtttcgaaaacacattgac
ttgtgcaagaagaaaattgggagcgcagagctgtcctttgagcatgctgcgtggatgtcg
aaacaattccaggcctttggagatttatttgatgaagccattaagttggggctgacagca
attcaaacacagaaccctggtttctactatcagcaggctgcttactatgcccaggagcga
aaacagcacgcaaaagccctctgtaaccatgacgctgctgtggtgtaccccagtcctgat
cccttggaaacaccaacaggtgttcttgacttctatggacagaggccctggagacaagga
atactaagctttgacctctcagaccctgaaaaagagaaagcagggattctcgccattcag
ctgaaggagagaagtgttgtccactccgagatgataatcactcttctgagcaatgccgtt
gcacagttcaagaagtacaagtgtccacggatgaagagccacctcatggttcagatggga
gaggagtattattatgcgaaggactataccaaagctttgaagctgctggactatgtgatg
tgtgactaccggagtgaagcatggtggactctcctcacatctatattgacaacagccctg
aagtgttcctacctcatggcccagttaaaagattatattacttactctctggaactcctt
ggaagagcttcaactctgaaagatgaccagaaatctcggatagaaaagaacctcatgaat
gttttaatgaatgaaagtcctgaccctgaacctgactgtgacgccttagcagtaaagact
gctcagaagctgtgggcagaccgggtctctctggctggcagcaatgttttcacaataggc
gtacaggacttcgtgccatttgtgcagtgcaaagccaagttccatgctcccagttttcac
gtggatgttcctgtccagtttgatgtttatctgaaggccgactgcccacaccccattagg
ttttccaagctctgtgtcagctttaataatcagggttacaaccagttctgtgtattggag
gaagcatcaaaggcaagtgaagtcttagaaaatctgactcaaggaaagatgtgcttagtt
cctggcaaaacaagaaaattgttatttaaatttgttgccaaaactgaagatgtgggaaag
aaaatagagatcacctctgtggatctgtttctgggcagcgagtcaggcaggtgtgtggtt
ttgagctggcaaggaggaggaggggatgctgcttcctcccaggaagccctgcaggctgca
aggtctttcaagaggcggccaaagcttccggacgatgaggttcactgggacagcatcata
gtccaggcaagcacaatgatcatttccagagttccaaacatttctgtacatctgcgacat
gagcctcctgctctaatgaatgagatgtattgtttggttgtaactgttcaatcccaggaa
aagtcccaaatcagggacgtgaagctcactgctggcctaaagccagggcaggatgccaac
ctgactcagaagacccatgtgacacttcacggagcagagctgtgtgatgagtcctaccca
gccttactcaccgacattcctgtaggagacttaaacccaggggagcagctggagaaaaca
gtgtatgttcgctgtggaacagtgggttccagaatgttccttgtgtatgtttcttacctg
atcaatacaactgttgaaggaaaaggaattatgtgcaagtgtcacaaggatgaaacagtg
acaatagaaactgtctttccatttgatgtcgcagtcagatttgtttccacaaagtttgag
cacctggaaagagtctatgcagatatcccctttttgttgatgacggatattttaagtgcc
tcaccttgggccctcacaatcgtgtccagtgagctacagcttgctccgtctatggctgca
atggatcatctggagtcccaaatagacaaagttgtcttacagacaggagagagcgctagt
gagtgcttctgtcttcgctgcccatctgctgggaaccttgaaggtggagtggcaacagga
cattacattatctcctggaagaggtcctcaggcatggaaaacatccccgccatcagcacc
atcatcacactgcctcacgtgattgttgaaaacatccctctccatgtgaacgcagacctg
ccctcgtttggacgagtcagagagtcgttacctgtcaggtatcacctacagaataagacc
gacttggttcaagatgtggaaatttctgtggagcccagtgatgccttcatgttctcaggc
ctcaaacagatccgattacgtattctacctggcaccaaacaggagatgctatataatttc
tatcctctgatggctgggtaccaacagctaccatcgctcaacatcaacctgctgaggttt
cccaacttcaccaaccagctgctcagacgcttcataccaaccagcatttttgtgaagcca
cagggtcgactcttggaggacacctccatcgctgctgcatga

DBGET integrated database retrieval system