KEGG   Rattus norvegicus (rat): 290757
Entry
290757            CDS       T01003                                 

Gene name
F11, LRRGT00086
Definition
(RefSeq) coagulation factor XI
  KO
K01323  coagulation factor XI [EC:3.4.21.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    290757 (F11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    290757 (F11)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.27  coagulation factor XIa
     290757 (F11)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   290757 (F11)
SSDB
Motif
Pfam: Trypsin PAN_1 PAN_4 PAN_2
Other DBs
NCBI-GeneID: 290757
NCBI-ProteinID: NP_001041313
RGD: 1309364
Ensembl: ENSRNOG00000013684
UniProt: Q6TUF8
Position
16q11
AA seq 556 aa
MEIPRIKLTSLLLVPRQRGNLLTRTKLGSLPMCPSVDKCIKQMLEVRTKFRPCTSCPGYW
LSDLYYNQSAVRQRWNISLVACWQYGLFGQNRFACILKDSLTETLPMVHMTGAVSGYSFK
QCPQQLSACSKNVYVNLDMKGMNYNSSAVKNARECQERCTNDAHCQFFTYATGHFPSVDH
RFSHRTACIRDIFPNTVLADLNIDSVLAPDAFVCRRICTHHPTCLFFTFFTQAWPKESQR
HLCLLKTSESGFPSTRITKSNALSGFSLQHCRHSIPVFCHPNFYNDTDFLGEELDIVDVK
GKESCQKMCSDNVRCQFFTYYPSRGSCSERNMHNQNQAQGVRRSCVCSRRVAMAGDPAHH
PGTPVWRLHHWKPVDIDSGSLFLWVSINDIRLGSSSPSTETPKTLRVYGGIVNQSEINED
TTFFRVQEMIIHDQYTSAESGFDIALLKLEPAMNYTDEVQSTLQKAKVPLVSNEECQTRY
RKHKITNKVICAGYKEGGKDTCKGDSGGPLSCKHNGVWHLVGITSWGEGCGQKERPGVYT
NVAKYVDWILEKTQSE
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggagatccccaggattaaacttacatcattactcttggtgcctcgccagcgtggaaac
ttactcacaagaaccaagttagggagtctgcccatgtgtccatcagtagacaaatgcata
aagcaaatgctggaagtacgcacaaagttccgcccttgtacttcctgtcccggctattgg
ctgtcagatctttactataaccaatcagcagtaagacaacgctggaacatctctttggtt
gcctgttggcaatatgggctgtttgggcagaacaggtttgcctgcatcctgaaggacagt
ctcacagaaacattgccgatggtacacatgacaggagcggtttctggatattccttcaag
caatgccctcagcaattaagtgcttgcagcaaaaacgtgtacgtgaacctggacatgaag
ggcatgaactataacagttctgccgtgaagaatgctcgagaatgtcaggagagatgcacc
aacgatgcccactgccagtttttcacatacgcaacggggcattttcccagtgtggaccat
cgtttctctcatcgtacagcttgtatcagggacattttcccgaacaccgtgcttgcagac
cttaacattgacagcgtgttggccccagatgcttttgtctgtcgtcgcatttgcacgcat
caccccacgtgcctgttttttacattctttacccaagcgtggccaaaagaatcccagaga
catctttgcctccttaaaacatctgaaagcggatttccaagcacacgcatcacaaagagc
aacgccctttccgggttcagtctccagcactgcaggcacagcatcccagtattctgtcat
ccgaacttttacaacgacactgatttcttgggagaagaactggacatcgtcgatgtgaaa
ggcaaagaatcctgccagaaaatgtgctctgacaacgtccgctgccagttctttacctat
tatccctctcgaggatcttgcagtgagaggaatatgcacaaccaaaatcaggcccagggt
gttcggaggagctgcgtctgttcacggcgagtggccatggcaggtgaccctgcacaccac
ccagggacacctgtgtggaggctccatcattggaaaccggtggatattgacagcggctca
ttgtttctctgggttagtattaacgatattcgcctggggtcgtcatcaccaagtacagag
acacctaaaactctgcgtgtctacggtggtattgtaaatcaatcagaaataaatgaagat
accactttcttcagggttcaagaaatgataattcatgatcaatatacatcggcagaaagt
gggtttgacattgccctcttaaaactggaaccggccatgaattacacagatgaagtacaa
agtactctccagaaagccaaggtaccattggtgtcgaatgaagaatgtcaaacaagatac
agaaaacataaaataaccaacaaggtgatctgtgcaggatataaggaaggagggaaggat
acgtgtaagggagattctggagggcccctgtcctgcaaacacaatggggtctggcacttg
gtgggcatcacaagctggggtgaaggctgcggccagaaagagaggccgggtgtctacacc
aacgtggccaagtatgtggactggattttggagaaaactcagtcggaatga

DBGET integrated database retrieval system