KEGG   Rattus norvegicus (rat): 290798
Entry
290798            CDS       T01003                                 

Gene name
Dctn6
Definition
(RefSeq) dynactin subunit 6
  KO
K10428  dynactin 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04962  Vasopressin-regulated water reabsorption
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    290798 (Dctn6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    290798 (Dctn6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    290798 (Dctn6)
   05016 Huntington disease
    290798 (Dctn6)
   05022 Pathways of neurodegeneration - multiple diseases
    290798 (Dctn6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    290798 (Dctn6)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    290798 (Dctn6)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     290798 (Dctn6)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     290798 (Dctn6)
SSDB
Motif
Pfam: Hexapep
Other DBs
NCBI-GeneID: 290798
NCBI-ProteinID: NP_001099555
RGD: 1307549
Ensembl: ENSRNOG00000013254
UniProt: D4ADD8
Position
16
AA seq 190 aa
MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIIIGEGNLIEEQA
LIINAHPDNIIPDTEDPEPKPMIIGTNNVFEVGCHSQAMKMGDNNVIESKAYVGRNVILT
SGCIIGACCSLNTFEAIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKT
MKGSSTPVKN
NT seq 573 nt   +upstreamnt  +downstreamnt
atggcggagaagactcagaagagtgtgaagatcgctcccggagcagtagtatgtgtagaa
agtgaaatccgaggagatgtaaccataggtcctaggacggtgatccaccctaaagcccga
atcatcgcagaggccggcccaatcattatcggcgaaggaaacctaatagaggagcaggcc
ctcatcataaacgcccatccagataacatcatcccagacactgaagacccagaacccaaa
cccatgatcatcggcaccaacaacgtgtttgaagtgggctgccattcccaagccatgaaa
atgggagacaataatgtcattgagtcaaaagcgtacgtaggcaggaatgtcatcctgacc
agcggttgcatcattggcgcttgctgcagcctgaacacctttgaagccatccctgagaac
acagtgatctatggcgccgactgcctgcggcgggtgcagacggagcggccacagccccag
acactacagctggatttcttgatgaagatcttgcccaattaccaccacctgaagaaaaca
atgaaaggcagctcgactccagtcaagaactga

KEGG   Rattus norvegicus (rat): 29167
Entry
29167             CDS       T01003                                 

Gene name
Dctn1
Definition
(RefSeq) dynactin subunit 1
  KO
K04648  dynactin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04962  Vasopressin-regulated water reabsorption
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    29167 (Dctn1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    29167 (Dctn1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    29167 (Dctn1)
   05016 Huntington disease
    29167 (Dctn1)
   05022 Pathways of neurodegeneration - multiple diseases
    29167 (Dctn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29167 (Dctn1)
   03036 Chromosome and associated proteins [BR:rno03036]
    29167 (Dctn1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    29167 (Dctn1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    29167 (Dctn1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     29167 (Dctn1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     29167 (Dctn1)
SSDB
Motif
Pfam: Dynactin CAP_GLY
Other DBs
NCBI-GeneID: 29167
NCBI-ProteinID: NP_077044
RGD: 62038
Ensembl: ENSRNOG00000010048
UniProt: P28023
Structure
PDB: 
2MPX 2M02

Position
4
AA seq 1281 aa
MAQSKRHMYNRTPSGSRMSTEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGV
ILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKILKRE
GADAAAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGPSSSLGPSGSASAGELSS
SEPSTPAQTPLAAPIIPTPALTSPGAAPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRSE
DKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADT
ADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQL
KQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAE
STIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARE
TELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEA
SVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPG
GDHDCVLVLLLMPRLICKAELIRKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSL
SLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPL
TKAIKYYQHLYSIHLAEQPEESTMQLADHIKFTQSALDCMSVEVGRLRAFLQGGQEATDI
ALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLLDCRKHLTWVVAV
LQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGSPSSSPYECLRQSCSILISTM
NKLATAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLK
IKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQTLLRKKEKEFEETMDALQ
ADIDQLEAEKTELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGEEQQRGGTPGQAPGA
LPGPGPVKDSPLLLQQISAMRLHISQLQHENSILRGAQMKASLAALPPLHVAKFSLPPHE
GPGGNLLSGALYRKTSQLLEKLNQLSTHTHVVDITRSSPAAKSPSAQLMEQVAQLKSLSD
TIEKLKDEVLKETVTQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGLG
QRHRLVLTQEQLHQLHGRLIS
NT seq 3846 nt   +upstreamnt  +downstreamnt
atggcccagagcaagaggcacatgtacaatcggacgcccagtggcagcaggatgagtacg
gaggcaagcgcccggcccctgcgggtcggctcccgtgtggaggtgattgggaagggccac
cgtggtactgtggcctatgttggagctacactctttgccactggcaagtgggtgggcgtg
atcctggatgaagcaaaaggcaagaacgatggtaccgttcagggaaggaagtatttcaca
tgcgatgaaggccacggcatctttgtacgccaatcccagatccaagtatttgaagatgga
gcagatactacttccccagagactcctgattcttctgcttcaaagatcctcaagagagag
ggagctgatgcagctgcaaagaccagcaaactgcggggactgaagcctaagaaggcaccg
acagcccgaaagaccacaactcgacggcccaagcctactcgcccagccagtactggggtg
gctgggcccagtagctccttgggcccctctggatcagcatcagccggtgaactgagcagc
agtgagcccagcaccccagctcagactccgctggcagcacccatcatccccacaccggcc
ctcacctctcctggagcagcacccccacttccttctccctctaaggaagaggaagggctg
agggcccaggtacgggacctggaggagaagctggagaccttgcgtctgaaacgctcagaa
gacaaagcaaagctgaaggagctggagaagcacaagatccagctggagcaggtgcaggaa
tggaagagcaaaatgcaggagcagcaggcggacctgcagcggcgcctcaaggaggcgcgg
aaggaagccaaggaggcactggaggcaaaggagcgctacatggaggagatggcagacaca
gccgacgccatcgagatggccactctggacaaggagatggccgaggagcgggccgagtcc
ctgcagcaggaggtggaggcactgaaggaacgagtagacgaactcaccacagacttggag
atcctcaaggctgaaattgaagagaaaggctctgatggggctgcgtccagctaccagctc
aaacagctggaggagcagaatgcccgcctgaaggacgccctggtgaggatgcgagatctc
tcttcctcagagaagcaggagcatgtgaagctccagaagctcatggaaaagaagaaccag
gagctggaggttgtgaggcagcagcgtgagcgtcttcaggaggaactgagccaggcagag
agcaccatcgatgagctcaaagagcaggtggacgctgctctgggagctgaggagatggtg
gagatgctgactgaccggaacctgaatctggaggagaaagtgcgagaattacgggagact
gtgggggacttggaagcgatgaatgagatgaatgacgagctgcaggagaacgcacgcgag
acagaactggagctgcgtgagcagctggacatggcaggcgcccgagtaagggaggcccag
aagcgagtggaagccgcccaggagacggtcgccgactaccagcagaccatcaagaagtac
cgccagttgactgcccacctacaggatgtcaatcgggagctgaccaaccagcaggaagcg
tctgtggagagacagcagcagccaccgccagagacttttgatttcaaaatcaagtttgct
gagaccaaggctcatgccaaggcgatcgagatggagttgaggcagatggaagttgcccag
gccaaccggcacatgtccctgctgacggcctttatgcctgacagcttccttcggccaggg
ggagaccatgactgtgtcctggtgctgctgctcatgccccgactcatctgcaaggcagag
ctcatccggaagcaggcccaggagaagtttgacctgagtgagaactgttcggagcggcct
gggctgcgaggggctgctggggagcagctaagctttgccgccgggctggtgtactcgctg
agtctgctgcaggccacactgcaccgctacgagcatgccctctctcagtgcagcgtggac
gtgtacaagaaggtaggcagcctgtacccggagatgagtgcccacgagcgctccttagat
ttcctcatcgagctgctgcacaaggatcagctggacgagactgtcaacgtggagcccctc
accaaggccatcaagtactaccagcatctgtacagcatccacctcgctgagcagcccgag
gagtccaccatgcagctggctgaccacatcaagttcacccagagtgccctggattgtatg
agcgtggaggtggggcggctgcgtgccttcttgcagggtgggcaggaggcaacagatatt
gctcttcttctgcgagacctggaaacatcctgcagtgacatccgtcagttctgcaagaag
atccgacggcgaatgccagggacggatgctcctgggatcccagcagcgctggccttcggc
tcacaggtgtctgacacactcctggactgcaggaagcacctgacgtgggtggtagctgtt
ctgcaggaggtggcagctgcagccgcccagctcatcgcccccttggcagagaacgagggg
ctgcccgtggctgcactggaggagctggctttcaaagcaagcgagcagatctacgggagc
ccctccagcagcccctacgaatgtctgcgccagtcatgctccatcctcatcagcacgatg
aacaagttggccacagccatgcaggaaggcgagtatgacgcagagcggcccccgagcaag
cctcctccagttgaacttcgggctgcagcactgcgtgcagagatcacagatgctgaaggt
ctgggtttgaagcttgaggatcgagagacagtcatcaaggagttaaagaagtcactcaag
attaagggagaggagctgagtgaggccaacgtgcggctgagcctcctggagaagaagctg
gacagcgctgccaaggatgctgatgagcgaatcgagaaagttcagactcggctggaggag
acgcagaccctgctacggaagaaggagaaagagtttgaggagacaatggatgcactccag
gctgacatagaccagctggaggcagagaagacagagctcaagcagcgcctgaacagccag
tccaagcgcactattgagggactccggggcccccctccatcaggcattgctaccctggtc
tctggcattgctggtgaggaacaacagcgagggggcactcctgggcaggctccaggcgcc
ttgccaggcccggggccggtgaaggactcaccactgctgcttcagcagatctctgccatg
aggttacacatctctcagctccagcatgagaacagcatcctcagaggagcccagatgaag
gcgtccttggcagctctgccccctctgcatgttgcaaagttttccctcccaccccatgag
ggccctggtggtaacctcctgtctggggcactgtatcgcaagaccagccagctgttggag
aaactaaaccaactgagcactcacacccacgtagtagacatcacccgaagcagcccggct
gccaagagcccatccgctcagcttatggaacaagtggcccagctcaagtctctgagcgac
accatcgagaagctcaaggatgaggtcctcaaggagacagtaactcagcgtcctggagct
actgttcccactgactttgccaccttcccttcatctgccttcctgagggccaaggaagag
cagcaagacgacacagtctacatgggcaaagtgaccttctcgtgtgcggcaggcctcgga
cagcgacaccgcctggtgctgacccaggagcagctgcaccagcttcacggtcgtctcatc
tcctaa

KEGG   Rattus norvegicus (rat): 294010
Entry
294010            CDS       T01003                                 

Gene name
Actr1a
Definition
(RefSeq) alpha-centractin
  KO
K16575  centractin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    294010 (Actr1a)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    294010 (Actr1a)
   05016 Huntington disease
    294010 (Actr1a)
   05022 Pathways of neurodegeneration - multiple diseases
    294010 (Actr1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    294010 (Actr1a)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    294010 (Actr1a)
   04147 Exosome [BR:rno04147]
    294010 (Actr1a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     294010 (Actr1a)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actin-related proteins
     294010 (Actr1a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   294010 (Actr1a)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 294010
NCBI-ProteinID: NP_001099834
RGD: 1307025
Ensembl: ENSRNOG00000019725
UniProt: P85515
Position
1
AA seq 376 aa
MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGP
KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKN
RERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSI
MRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQ
YYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVL
SGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSK
KEYEEDGARSIHRKTF
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggagtcctacgatgtgatcgccaaccagcctgttgtgatcgacaatggatccggtgtg
attaaagctggttttgctggtgatcagatccccaaatactgctttccaaactatgtgggc
agacccaaacatgttcgagtcatggcaggagccctcgaaggtgacatcttcattggcccc
aaagctgaggagcaccgggggctgctgtcaatccgctaccccatggaacatggcatcgtc
aaggactggaacgacatggagcgcatctggcaatatgtctattctaaggaccagctgcag
actttctcagaggagcatcctgtgctcctgactgaggcacctttaaaccctcggaaaaac
cgggagcgagcggcagaagttttcttcgagaccttcaatgtgccagctctcttcatctcc
atgcaagctgtgcttagcctttatgccacaggcagaaccacaggtgtggtgttggattct
ggggatggcgtcacccatgcagtcccgatttacgaaggcttcgccatgcctcactccatc
atgcgcattgacattgccggccgcgatgtctcacgcttcctccgcctctacctacgaaag
gagggctacgatttccactcctcctccgagtttgagattgtcaaggccataaaggaaaga
gcttgctacctgtccataaacccccagaaggatgagacactggagacggagaaggctcag
tactacctgcccgatggcagcaccattgagattggcccttccaggttccgggcccctgag
ctgctgttcaggcctgacttgattggcgaggagagtgagggtatccatgaggtgctggtg
ttcgctatccagaagtcagacatggatttacggcggacgctcttttccaacattgtcctc
tcaggaggttctaccctcttcaaaggttttggggacaggctactgagtgaagtgaagaaa
ctggctccaaaagatgtgaagatcaggatatctgcaccccaggagagactgtattccaca
tggattggaggctctatccttgcctccctggatacctttaagaagatgtgggtctccaag
aaggaatatgaagaagatggtgcccgatccatccacaggaaaaccttctaa

KEGG   Rattus norvegicus (rat): 299121
Entry
299121            CDS       T01003                                 

Gene name
Actr10
Definition
(RefSeq) actin-related protein 10
  KO
K16576  actin-related protein 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    299121 (Actr10)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    299121 (Actr10)
   05016 Huntington disease
    299121 (Actr10)
   05022 Pathways of neurodegeneration - multiple diseases
    299121 (Actr10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    299121 (Actr10)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    299121 (Actr10)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     299121 (Actr10)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actin-related proteins
     299121 (Actr10)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 299121
NCBI-ProteinID: NP_001009602
RGD: 1306515
Ensembl: ENSRNOG00000007504
UniProt: Q5M9F7
Position
6
AA seq 417 aa
MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKRAGMSKPIKVVQYNIN
TEELYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVLL
APSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLL
EQCTVDTGAAKGQSLPSVMGSVPESVLEDIKVRTCFVSDLQRGLQIQAAKFNIDGNNERP
SPPPNVDYPLDGEKILHVLGSIRDSVVEILFEQDNEEKSVATLILDSLLQCPVDTRKQLA
ENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKNFRIHTPPAKANCVAWLGGAV
FGALQDILGSRSISKEYYNQTGRTPDWCSLNNPPLEMMFDVGKTQPPLMKRAFSTEK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgccgctctatgagggcctcgggagcggcggcgagaagacggcggtcgtgatcgaccta
ggagaagccttcaccaagtgtggattcgcaggagaaactggtccacgatgcataattcct
agtgtgataaaaagagctggcatgtctaagccgatcaaagttgtccagtataatatcaat
acagaagaactatattcctacctaaaggaattcatccacatactgtatttcaggcatctg
ttggtgaatcccagagaccgccgggttgtggttattgagtcagtgttatgtccttcccac
ttcagagagacccttactcgtgttcttttcaaatattttgaggtcccatctgtcctactt
gctccaagtcatctgatggcactcctgacgctcgggattaattccgccatggtcctggat
tgtggatatagggaaagcctggtgttgcctatctatgaaggcatcccagtactgaattgc
tggggagctctgcccttaggaggaaaagctcttcacaaggagttggaaactcagctgttg
gaacaatgcactgttgacactggtgctgctaaaggacagagccttccctcggtgatgggt
tcagttccagaaagcgtcctagaagatattaaagtgcggacctgctttgtaagtgacctg
cagcgtggactacaaatccaagcagcaaagtttaatattgatggaaataatgagcgtccc
tctccacctccaaatgtcgactatccattggatggagagaaaattttacatgtgcttgga
tcaatcagagattcagtcgtggaaattctttttgaacaagataatgaggagaagtcagtt
gccactttaatattggattcccttttacagtgcccagtagacaccaggaagcaactggca
gagaatctggtaatcataggaggcacgtctatgttgccaggatttctccacagattgctt
gcagaaatacggtatttggtagaaaagccaaaatacaaaaagacacttggcaccaagaac
ttccgaattcatactccacctgcaaaggctaattgtgtggcctggttgggaggcgctgtt
tttggagcattgcaagacatacttgggagccgctccatttcaaaggagtactataatcag
acgggccgcacacctgactggtgctctctgaacaacccgcctctggagatgatgtttgat
gttgggaagacgcagccaccgctgatgaaaagagcattttccaccgagaaataa

KEGG   Rattus norvegicus (rat): 299850
Entry
299850            CDS       T01003                                 

Gene name
Dctn2
Definition
(RefSeq) dynactin subunit 2
  KO
K10424  dynactin 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04962  Vasopressin-regulated water reabsorption
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    299850 (Dctn2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    299850 (Dctn2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    299850 (Dctn2)
   05016 Huntington disease
    299850 (Dctn2)
   05022 Pathways of neurodegeneration - multiple diseases
    299850 (Dctn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    299850 (Dctn2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    299850 (Dctn2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     299850 (Dctn2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     299850 (Dctn2)
SSDB
Motif
Pfam: Dynamitin DUF2408 SF-assemblin PI_PP_I ZapB
Other DBs
NCBI-GeneID: 299850
NCBI-ProteinID: NP_001004239
RGD: 1303182
Ensembl: ENSRNOG00000025481
UniProt: Q6AYH5
Position
7
AA seq 402 aa
MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAEELSSTSVEHIIVNPNAAYDKFKDK
RVGTKGLDFSDRIGKTKRTGYESGDYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKI
KTTVKESATEEKLTPVVLAKQLAALKQQLVASHLEKLLGPDAAINLADPDGALAKRLLLQ
LEATKSSKGSSGGKSTGGTPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELEATVR
CDQDAQNPLSAGLQGACLMETVELLQAKVNALDLAVLDQVEARLQSVLGKVNEIAKHKAS
VEDADTQNKVHQLYETIQRWSPVASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQM
MASSLKDNTALLTQVQTTMRENLATVEGNFASIDARMKKLGK
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggcggaccctaaatacgccgatctccccggcattgccaggaacgagccagatgtttat
gaaaccagcgacctacctgaggatgatcaagcagagtttgatgcggaggagctgagcagc
acaagtgtggaacacatcatcgtcaaccccaacgctgcctatgacaagttcaaggacaag
agagtagggacaaaggggcttgatttctcagatcgcattggaaagaccaagaggacagga
tatgagtctggagactatgaaatgcttggagagggtctgggagtaaaggagacaccacag
cagaagtaccaacgactactgcatgaagtccaggagctgacaacggaggtggagaagatc
aagacaacagtgaaggagtcagccactgaggagaagctcacccctgtggtgctggctaaa
cagctggccgctctgaagcagcagctggtagcttcccacctggagaagcttctgggacca
gatgctgccatcaacctcgctgacccagatggagccctagctaagcgcttactgctgcag
ctggaagcaaccaagagcagcaaaggcagctcagggggaaagagcacaggtggcactccc
ccagatagcagccttgtcacttacgaactccactcacggcctgagcaggacaagttctcg
caagctgccaaagttgcagaactcgagaagcgcctgacagagctggaggccactgtccgc
tgtgatcaggatgctcagaatcccctttctgcaggtctacagggagcctgccttatggaa
acggtagaactgttacaggccaaagtgaacgccctggaccttgcagttctggaccaagta
gaggctcgactgcagagtgtcctgggaaaggtgaatgagattgctaagcacaaggcatct
gtggaggacgcagacacacagaataaggtgcaccagctctatgagaccatccagcgctgg
agccctgtggcctccactctccctgagctggtacagagacttgtcaccatcaagcagctt
catgagcaagctatgcagtttggtcagctcctgacacacttggataccacccagcagatg
atggcgagttctcttaaggacaatactgccctcctgacccaggttcagacaacgatgcgt
gaaaacttggccacagttgaggggaattttgccagcattgatgctcgtatgaagaagctg
ggaaagtga

KEGG   Rattus norvegicus (rat): 308961
Entry
308961            CDS       T01003                                 

Gene name
Dctn5
Definition
(RefSeq) dynactin subunit 5
  KO
K10427  dynactin 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04962  Vasopressin-regulated water reabsorption
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    308961 (Dctn5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    308961 (Dctn5)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    308961 (Dctn5)
   05016 Huntington disease
    308961 (Dctn5)
   05022 Pathways of neurodegeneration - multiple diseases
    308961 (Dctn5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    308961 (Dctn5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    308961 (Dctn5)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     308961 (Dctn5)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     308961 (Dctn5)
SSDB
Motif
Pfam: Hexapep Hexapep_2 DUF4954 Fucokinase
Other DBs
NCBI-GeneID: 308961
NCBI-ProteinID: NP_001032867
RGD: 1305654
Ensembl: ENSRNOG00000018048
UniProt: Q4KM59
Position
1
AA seq 182 aa
MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIIMNDCIIRGDLANVRVGRH
CVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRC
VLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLT
QV
NT seq 549 nt   +upstreamnt  +downstreamnt
atggagttgggcgaactgctgtataacaagtccgagtacatcgagacggcatctgggaac
aaagttagtcgccagtctgttttgtgtggaagccagaacatcgttctcaatggcaagacc
attataatgaatgactgtatcatccgaggagacctggcaaatgtaagagttggacgtcac
tgtgttgtgaaaagccgtagtgtcataaggccaccgttcaaaaaattcagcaaaggtgtt
gcattctttcctctgcatattggggatcatgtctttattgaggaagactgtgtggtcaac
gctgcccagattggttcttatgttcacgttgggaagaactgtgtgattgggcgccggtgt
gtcttgaaagactgctgcaaaattcttgacaatacagtattacctccagaaactgtggtc
cccccattcactgtcttctccggctgtccaggactcttctcaggggagctcccagagtgc
acacaggagctgatgatcgatgtcaccaaaagctactaccagaagtttctacccctaaca
caagtctag

KEGG   Rattus norvegicus (rat): 316333
Entry
316333            CDS       T01003                                 

Gene name
Actr1b
Definition
(RefSeq) beta-centractin
  KO
K16575  centractin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    316333 (Actr1b)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    316333 (Actr1b)
   05016 Huntington disease
    316333 (Actr1b)
   05022 Pathways of neurodegeneration - multiple diseases
    316333 (Actr1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    316333 (Actr1b)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    316333 (Actr1b)
   04147 Exosome [BR:rno04147]
    316333 (Actr1b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     316333 (Actr1b)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actin-related proteins
     316333 (Actr1b)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   316333 (Actr1b)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 316333
NCBI-ProteinID: NP_001034117
RGD: 1307380
Ensembl: ENSRNOG00000016789
Vega: OTTRNOG00000000854
UniProt: B2RYJ7
Position
9
AA seq 376 aa
MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGP
KAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKN
REKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSI
MRVDIAGRDVSRYLRLLLRKEGADFHTSAEFEVVRTIKERACYLSINPQKDEALETEKVQ
YTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVLAFAIHKSDMDLRRTLFSNIVL
SGGSTLFKGFGDRLLSEVKKLAPKDVKIKISAPQERLYSTWIGGSILASLDTFKKMWVSK
KEYEEDGSRAIHRKTF
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggagtcctacgacatcatcgctaaccagcccgtggtcatcgacaatggttcaggggtg
atcaaggctggctttgcaggagaccagattcctaagtactgtttcccaaactatgtcgga
cggccaaagcacatgcgggttatggctggagccctggagggggacctgttcattggaccg
aaagcagaggagcaccgggggctgctgaccatccgataccctatggagcacggtgtggta
cgggactggaacgacatggagcgcatctggcagtacgtctactctaaggaccagctacag
accttctccgaggagcatcctgttcttctaacggaggccccactgaaccccagtaagaac
cgggagaaggcggcagaggtgttctttgaaaccttcaacgttcctgcactgtttatctcc
atgcaggccgtgctcagcctgtacgcaacaggacgcactactggagtggttttagactcg
ggggacggggtcactcacgctgtccccatctatgagggctttgccatgccgcactccatc
atgcgggtagacattgcgggccgggacgtctcccgatacctgaggctgctgctgcgcaag
gaaggcgctgacttccacacctcagctgagtttgaggttgtgcggaccatcaaagagcga
gcttgctacctgtccatcaacccacaaaaggacgaggctctagagactgagaaggtgcag
tacacccttccagacggcagcacgctcgatgtggggcctgcacgcttccgagcccctgag
ctgctgttccagccagacctggttggggatgagagtgagggactccatgaagttttggcc
ttcgccatccacaagtcggacatggacctccgccggacgctcttctccaatatcgtgctg
tcagggggctcaacactctttaaaggcttcggagaccggttactaagtgaagtaaagaaa
cttgccccaaaggatgtgaaaatcaagatctctgctcctcaggaaaggctgtactccaca
tggatcggcggctccatcctcgcctcactggacaccttcaagaagatgtgggtatccaaa
aaggaatatgaagaagatggctcccgtgcgattcatcgcaaaaccttctaa

KEGG   Rattus norvegicus (rat): 362504
Entry
362504            CDS       T01003                                 

Gene name
Dctn3
Definition
(RefSeq) dynactin subunit 3
  KO
K10425  dynactin 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    362504 (Dctn3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    362504 (Dctn3)
   05016 Huntington disease
    362504 (Dctn3)
   05022 Pathways of neurodegeneration - multiple diseases
    362504 (Dctn3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    362504 (Dctn3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    362504 (Dctn3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     362504 (Dctn3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     362504 (Dctn3)
SSDB
Motif
Pfam: Dynactin_p22 DUF4011 Spidroin_MaSp DivIC Pox_A_type_inc TetR_C_24
Other DBs
NCBI-GeneID: 362504
NCBI-ProteinID: NP_001102129
RGD: 1309547
Ensembl: ENSRNOG00000014208
UniProt: D4A1B8
Position
5
AA seq 186 aa
MAALTDVQRLQSRVEELERWVYGPGGTRGSRKVADGLVKVQVALGNIASKRERVKILYKK
IEDLIKYLDPEYIDRIAIPEASKLQFILAEEQFILSQVALLEQVNTLVPMLDSASIKAVP
EHAARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLCQLEAAKQ
VKPAAE
NT seq 561 nt   +upstreamnt  +downstreamnt
atggcggctctgaccgatgtacagcggctacagtcccgagtggaggagctggagcgctgg
gtgtacgggccgggcgggacccgaggctctaggaaggtagctgatggtctagtcaaggtg
caggtggctttagggaacattgccagtaagagggagagggtgaagattctctacaaaaag
attgaagacctgatcaaatacctggatcctgagtacattgatcgcattgctatacctgag
gcctcgaagttgcagttcatcttggcagaggaacagttcatcctctcccaggtggcactc
ttggaacaagtgaacaccttggtgcccatgctggacagcgcttctatcaaagccgttcct
gagcatgctgcccgcctgcagcgcttggctcagatccacatccaacagcaggaccagtgt
gtggagatcactgaggagtccaaggctctcctggaggagtataacaagactacaatgctt
ctctccaagcagtttgtgcagtgggacgagctactctgccagctagaggctgccaagcaa
gtgaagccagcagcagaatga

KEGG   Rattus norvegicus (rat): 84428
Entry
84428             CDS       T01003                                 

Gene name
Dctn4
Definition
(RefSeq) dynactin subunit 4
  KO
K10426  dynactin 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04962  Vasopressin-regulated water reabsorption
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    84428 (Dctn4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    84428 (Dctn4)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    84428 (Dctn4)
   05016 Huntington disease
    84428 (Dctn4)
   05022 Pathways of neurodegeneration - multiple diseases
    84428 (Dctn4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    84428 (Dctn4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    84428 (Dctn4)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     84428 (Dctn4)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     84428 (Dctn4)
SSDB
Motif
Pfam: Dynactin_p62
Other DBs
NCBI-GeneID: 84428
NCBI-ProteinID: NP_445856
RGD: 71023
Ensembl: ENSRNOG00000019298
UniProt: Q9QUR2
Position
18
AA seq 467 aa
MASLLQSERVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPS
AEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRD
VGMADKSVASGGWQEPENPHAQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSQ
HTIHVVDKYSLGTRLQRPRAGASISTLAGLSLREGEDQKEVKIEPAQAVAEVEPLPEDYY
TRPVNLTEVTTLQQRLLQPDLQPVSASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTS
IKFKIQLVAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLLECEEGDPDNIN
STAKVVVPPKELILAGKDAAAEYDELAEPQDFQDDPDIVAFRKANKVGIFIKVTPQREEG
DVTVCFKMKHDFKNLAAPIRPMEESDQGTEVIWLTQHVELSFGPLLP
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggcgtccttgctgcagtcggagcgggttctctatctcgtccaaggagaaaagaaggtt
cgggccccgctctcacagctctacttctgccgctactgcagtgagcttcgatcgctggaa
tgtgtgtcacacgaggtggactctcattattgtcccagctgcttagaaaacatgccatca
gctgaagccaaattaaaaaagaatagatgtgccaactgctttgactgtcctggatgcatg
cacaccctctccacccgagctacaagcatctccacacagcttccagacgacccagccaaa
accactatgaagaaagcctattacctggcctgtggattttgtcgatggacatctagagat
gtgggcatggcagacaaatctgtagctagtggtggttggcaagaaccagaaaatcctcat
gcacaacggatgaacaaattgattgaatattaccagcagcttgctcagaaggaaaaggtt
gaacgagatcgcaagaaactggcacggcgaagaaattacatgcctttggctttttcgcaa
cacactattcatgtagtggacaagtacagccttgggaccaggcttcagcgaccacgagct
ggtgcatccattagtacacttgccggactttcccttagagaaggagaagaccagaaggag
gtaaagattgagccagctcaggccgtcgctgaagtggagcctctgcctgaagactattac
acacgaccagtgaacctgacagaggtgaccacccttcagcagcgcctcttacagcctgac
ctgcagcctgtctcagcctcgcagctttatcctcgacacaagcaccttctgatcaaacgg
tccctgcgctgtcggaaatgtgaacacaatttgagcaaaccagaatttaatccaacatct
atcaaattcaaaatccagttggttgctgtcaattatattccagaagtgagaatcatgtcg
atccccaatcttcgctacatgaaggaaagccaggtcctcttgactcttacaaatccagtg
gagaacctcacccatgtaactctgctggagtgcgaagagggggaccctgataacatcaac
agcactgctaaggtggtggtgcctcccaaagagctcatcttagccggcaaggatgcagca
gcagagtacgatgagctggcagagccccaggacttccaggatgaccctgacattgtagct
ttcagaaaagccaacaaagtaggcatcttcatcaaagtcaccccacagcgtgaggaaggg
gacgtgaccgtgtgcttcaagatgaaacatgattttaaaaacctggctgcccccatccgc
cctatggaagaaagcgaccagggcacagaagtcatttggctcactcagcatgtggaactg
agctttggccctcttcttccttaa

DBGET integrated database retrieval system