KEGG   Rattus norvegicus (rat): 290923
Entry
290923            CDS       T01003                                 

Gene name
Aga
Definition
(RefSeq) N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase precursor
  KO
K01444  N4-(beta-N-acetylglucosaminyl)-L-asparaginase [EC:3.5.1.26]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00511  Other glycan degradation
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    290923 (Aga)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    290923 (Aga)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.26  N4-(beta-N-acetylglucosaminyl)-L-asparaginase
     290923 (Aga)
SSDB
Motif
Pfam: Asparaginase_2
Other DBs
NCBI-GeneID: 290923
NCBI-ProteinID: NP_001026811
RGD: 1309646
Ensembl: ENSRNOG00000000108
UniProt: P30919
Position
16
AA seq 345 aa
MARKWNLPFLLLPLVLGIPLVRGSNPLPLVVNTWPFKNATEAAWWTLVSGGSALDAVEKG
CAMCEKEQCGGTVGFGGSPDEVGETTLDAMIMDGTAMDVGAVGGLRRIKNAIGVARKVLE
HTTHTLLVGDSATKFAVSMGFTSEDLSTNTSRALHSDWLSRNCQPNYWRNVIPDPSKYCG
PYKPPDFLEQNNRAHKEVDIHSHDTIGMVVIHKTGHTAAGTSTNGLKFKIPGRVGDSPIP
GAGAYADDMAGAAAATGDGDTLLRFLPSYQAVEYMRGGDDPARACQKVISRIQKYYPKFF
GAVICANVTGSYGAACNRLPTFTQFSFMVYNSLHNQAIEEKVDCM
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggcgcggaagtggaatctcccttttcttctcctgccgctcgttctgggtatacccctg
gtgcggggctccaaccctctacccctggtcgtcaacacttggccttttaagaatgccacc
gaagcagcgtggtggacattagtgtctggaggttctgccctggatgcggtggagaagggc
tgtgctatgtgtgaaaaggagcaatgtggtggtactgtaggctttggaggaagtcctgat
gaagttggggaaaccaccctggatgccatgatcatggatggcactgctatggatgtggga
gcagtgggaggccttagaagaattaaaaatgctattggagtggctcggaaagtcttggag
cataccacgcacacgcttttagtgggggactcagccaccaagtttgctgtaagtatgggg
tttaccagtgaggacttatctaccaatacctcaagagctcttcattcagattggctttct
cgaaactgccagccaaattattggagaaacgttataccagatccttcaaaatactgtgga
ccctacaaaccacctgatttcttagagcagaataaccgtgcccacaaagaagtggatatc
cacagtcatgatactattggcatggttgtaatccataagacgggacatactgctgctggc
acatctacaaatggtttaaaattcaaaatacctggtcgtgtaggagactcaccaatccct
ggagctggagcctatgctgatgacatggctggagcagctgcggccactggagatggtgac
acactcctgagatttctgccaagctaccaagctgtagaatatatgagaggaggagatgat
ccagccagagcttgccaaaaagtgatttcaagaattcagaaatattatccaaaattcttt
ggagctgttatatgtgccaatgtgacaggaagttatggtgctgcttgcaacagacttcca
acatttactcaatttagtttcatggtttataactctctacacaatcaggcgattgaagaa
aaagtagactgcatgtaa

DBGET integrated database retrieval system