KEGG   Rattus norvegicus (rat): 291006
Entry
291006            CDS       T01003                                 

Gene name
Diras2
Definition
(RefSeq) DIRAS family GTPase 2
  KO
K07841  DIRAS family, GTP-binding Ras-like 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    291006 (Diras2)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Ras Family
   Di-Ras [OT]
    291006 (Diras2)
SSDB
Motif
Pfam: Ras Roc MMR_HSR1 RsgA_GTPase MeaB DUF87 AAA_16 MMR_HSR1_Xtn AAA_24
Other DBs
NCBI-GeneID: 291006
NCBI-ProteinID: NP_001163049
RGD: 1305580
Ensembl: ENSRNOG00000032328
UniProt: D3ZHX3
Position
17p14
AA seq 199 aa
MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQIT
DTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVG
NKCDESPNREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDG
KKSKQQKRKEKLKGKCVVM
NT seq 600 nt   +upstreamnt  +downstreamnt
atgccggaacagagcaatgactaccgggtggccgtgtttggggcaggtggcgttggcaag
agctccctggttttgaggtttgtgaaagggaccttcagggagagctacatcccaactgtg
gaagacacctaccggcaggtgatcagctgtgacaagagcatctgtacgctgcagatcacc
gacacgaccgggagccaccagttcccggccatgcagcggctgtccatctccaagggccac
gccttcatcctggtctactccattaccagccggcagtccctggaggaactcaagcccatc
tatgagcagatctgcgagatcaagggggatgtggagagcatccccatcatgctggtgggg
aacaagtgtgacgagagccccaaccgcgaggtccagagcagcgaggcggaggccctggcg
cgcacgtggaagtgtgccttcatggagacatcggccaagctcaaccacaacgtcaaggaa
ctctttcaggagctactgaacctggagaagcgcaggaccgtgagcctccagatcgatggc
aagaagagcaagcagcagaagaggaaggagaagctcaagggcaagtgtgtggtcatgtga

DBGET integrated database retrieval system