KEGG   Rattus norvegicus (rat): 291015
Entry
291015            CDS       T01003                                 

Gene name
Ogn
Definition
(RefSeq) mimecan precursor
  KO
K08126  osteoglycin (osteoinductive factor, mimecan)
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    291015 (Ogn)
Proteoglycans [BR:rno00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class III
    291015 (Ogn)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_1 LRR_5
Other DBs
NCBI-GeneID: 291015
NCBI-ProteinID: NP_001099573
RGD: 1308171
Ensembl: ENSRNOG00000029792
UniProt: D3ZVB7
Position
17
AA seq 298 aa
MKTVHPTLLLLLFVPLTQQTPQTQLDSHVNSKYGTDNSEETKFIQDYEDKYLDGKNIKEK
ETMIIPDEKSLQLQKDEVIPSVPTKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKE
SAYLYARFNKIKKLTAKDFADMPNLRRLDFTGNLIEDIEDGTFSKLSLLEELTLAENQLL
RLPVLPPKLTLLNAKYNKIKSKGIKANTFKKLNKLSFLYLDHNDLESVPPNLPESLRVIH
LQFNSISSITDDTFCKANDTRYIRERMEEIRLEGNPIALGKHPNSFICLKRLPTGSYF
NT seq 897 nt   +upstreamnt  +downstreamnt
atgaagactgtgcatcctacgcttctcctgctattgttcgtgcctctgacacagcaaaca
ccacaaactcagctggactcacacgttaactctaagtatggaacagataattctgaagaa
accaaatttatccaggattatgaagataaatacctggatgggaaaaatattaaggaaaaa
gaaactatgataattcctgatgagaaaagtcttcagttacaaaaagatgaagtcatacca
tcagtgcccaccaagaaagaaaatgatgaaatgcccacatgcctgttgtgtgtctgttta
agtggctctgtctactgtgaagaagttgacattgatgctgtaccaccactgccaaaagaa
tcagcttatctttatgcacgattcaacaaaattaaaaagctgactgccaaggattttgca
gacatgcctaacttaagaagacttgattttacgggaaatttgatagaagacatagaagat
ggtactttttcaaaactttctctgttagaagaacttacacttgctgaaaaccaactacta
agacttccagttcttcctccaaagcttactttactcaatgccaaatacaacaaaatcaag
agtaaaggaattaaagcaaacacattcaaaaaactgaataaactctcttttctctatttg
gaccataatgatctggaatctgtgcctcctaatttaccagaaagtctacgtgtaattcac
cttcagtttaacagcatatcttcaattaccgatgatacattctgcaaggctaatgacact
cggtacattcgggagcgcatggaagagatccgcctggagggcaatccgattgctctggga
aagcatccaaacagctttatctgcttaaaaagattacccacagggtcatacttttaa

DBGET integrated database retrieval system