KEGG   Rattus norvegicus (rat): 291047Help
Entry
291047            CDS       T01003                                 

Gene name
Gcm2
Definition
(RefSeq) glial cells missing homolog 2
  KO
K21598  chorion-specific transcription factor GCM
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    291047 (Gcm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    291047 (Gcm2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Other transcription factors
   Others
    291047 (Gcm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCM
Motif
Other DBs
NCBI-GeneID: 291047
NCBI-ProteinID: NP_001099575
RGD: 1311127
Ensembl: ENSRNOG00000015008
UniProt: D3ZXW4
Position
17p13
AA seq 504 aa AA seqDB search
MPADSMQDPDPVLSYGMKLTWDINDPQMPQEPAHFDHFREWPDGYVRFIYSSQEKKAQRH
LSGWAMRNTNNHNGHILKKSCLGVVVCARACALKDGSHLQLRPAICDKARLKQQKKACPN
CHSALELVPCRGHSGYPVTNFWRLDGNAIFFQAKGVHDHPRPESKSETEGRRSALKRQMA
SFYQPQKRRSEEPEAGSTQDTRGHSNSTPVPEPSELFAMPADTSFPISGHSSLSFPNSDV
HRVTCDLPTFPGDVILPFQKYSNPSIYFPGPPWSYELASPGVTGSSPYPTLYKDPSIVPD
DPDWIHLNSLQYNVSSYGSYERSLDLTARYHGWKPTHGKAGLEEKVDCRPCQAVPTSPYY
NLELPCRYLPVAPAGTQALQTVITTTVAYQAYQHPALKHGDSVQEVSSLASCTYASENLP
MPIYPQALDPQEGAIQAASPSGRAPGIVPGDCQAARPTLAFPQETDPSRTAGADVWDVCL
SGVGSVMAYLDRTGQPFNLDNEDF
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgccagcagacagcatgcaggaccccgatcctgtgctttcctacgggatgaaactcaca
tgggacatcaatgacccgcagatgcctcaggaaccagctcacttcgaccacttccgggag
tggcctgatggctacgtgcgcttcatctacagcagtcaggagaagaaagctcagcgccac
ctgagcggctgggccatgcgcaacaccaacaaccacaatggccacatcctcaaaaagtcc
tgcctgggcgtggtggtgtgcgcacgcgcctgcgccctgaaggatggctcgcacctgcag
ctgaggccagccatctgcgacaaggctcgtctgaagcaacaaaagaaagcttgccccaac
tgtcattcagctttggagctggtcccttgccgaggacacagtggataccctgtcaccaac
ttctggagacttgatggcaatgcaatattttttcaggccaaaggagttcatgatcatccc
agaccagagagcaagtcagagacagaaggcagaagaagtgccctcaagagacagatggcc
tctttctaccaaccccagaaaaggagatcagaggagcctgaggcaggaagcactcaggac
accaggggacactccaatagcacgcctgtcccagaaccctcagaactgtttgctatgcct
gctgacaccagcttccctatttcagggcattcttccctttccttcccaaactctgatgtc
cacagagttacctgtgacctgcccacctttccaggagatgtaatacttccctttcagaaa
tattcaaatccaagcatttatttccctgggccaccttggagctatgaattggcaagtcct
ggagttacgggttcaagtccatatcctaccctgtataaagacccctccattgtccccgat
gaccctgactggatccatctaaactcactacaatataatgtgagttcatacggcagctat
gagagaagcttggatctcacagctagatatcatggctggaaacctacacatgggaaagct
ggccttgaggagaaggttgactgtaggccatgccaggctgtgcccacatcgccttattac
aacctagagctgccctgcaggtacctgccagtggccccggcaggtacccaggccctgcag
acagtgatcaccaccacagtggcttatcaggcttaccagcaccctgctctgaaacacggc
gacagcgtgcaggaggttagcagccttgccagttgcacctacgcttctgaaaacctccca
atgcccatctatccgcaagccttagaccctcaagagggagccatccaggcagcctcccct
tcagggagagcccctgggatagtccctggagattgccaggcagccagacctactctggct
ttccctcaagaaacagatccctccaggacagctggagcagatgtgtgggatgtgtgtctg
tctggggtgggctctgtgatggcttacttggataggacagggcaaccctttaacctcgac
aatgaggacttttag

DBGET integrated database retrieval system