KEGG   Rattus norvegicus (rat): 291061
Entry
291061            CDS       T01003                                 

Gene name
Riok1
Definition
(RefSeq) RIO kinase 1
  KO
K07178  RIO kinase 1 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    291061 (Riok1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    291061 (Riok1)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    291061 (Riok1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     291061 (Riok1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  RIO family [OT]
   291061 (Riok1)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-40S particles
   Kinases
    291061 (Riok1)
SSDB
Motif
Pfam: RIO1 APH
Other DBs
NCBI-GeneID: 291061
NCBI-ProteinID: NP_001093981
RGD: 1306086
Ensembl: ENSRNOG00000014049
UniProt: G3V7T0 Q6AY66
Position
17p12
AA seq 566 aa
MDCSLDRMATVVPGQFDDADSSDSEDKEVQSIQAKDDILLKNLQNDAAEVKGEDEIEEED
SYDYDSDWYLDDSTGKLTKGWTWNGSSNHQANRQTSNYNSAKMSTPIDKSLRKFENKINL
SKLNVTDSVINKVTVKLRQKEAESYRIKDKADRATVEQVLDPRTRMILFKLLHKEHISEI
HGCISTGKEANVYYASTPSGESRAIKIYKTSILMFKDRDKYVTGEFRFRRGYCKGNPRKM
VKTWAEKEMRNLSRLRTANIPCPEPIRLRSHVLLMSFIGKDDMPAPLLKNVQLSESKARE
LYLQVIQYMRKMYQDARLVHADLSEFNMLYHGGDVYIIDVSQSVEHDHPHALEFLRKDCA
NVNDFFFKHAVAVMTVKELFEFVTDPSITLENIDAYLEKAMEIASQRTMEEKTSQDHVDE
EVFKQAYIPRTLNEVKNYERDVDIMMRLKEEDMALNTQQDNILYQTVTGLKKDLSGVQKV
PALLESEVKEETCFDSDDAGSSECSDTDPEEQGDQAGCQNHTADPDVDKKERKKMVKEAQ
REKRKNKIPKHVKKRKEKTAKAKKGK
NT seq 1701 nt   +upstreamnt  +downstreamnt
atggactgcagtctggataggatggccacggtggtccccgggcaatttgacgacgcggat
tcctcagacagtgaagacaaagaagtgcagtcaatccaagcaaaagacgacattctactt
aaaaaccttcagaatgatgcagcagaggtgaagggcgaagatgagattgaggaggaagac
agctatgattatgacagtgactggtacttggacgactcgactggaaaactcaccaagggt
tggacctggaatggcagcagtaaccatcaggcaaatcgacagacttctaactacaattca
gccaaaatgtctactccaattgacaagtctttgcgaaaatttgaaaataagatcaatcta
agtaagctgaatgttactgattctgtcataaataaagtcaccgtaaaattgagacaaaaa
gaagcagaatcgtatcgcattaaagacaaggccgacagagcaactgtagaacaggttttg
gatcccagaacaaggatgattttattcaagttgttgcataaagagcacatatcagagata
catggctgcatcagtactggaaaagaagctaatgtatactatgctagcacacccagtgga
gagagcagagcaatcaaaatatacaaaacttctattttgatgttcaaagatcgtgataag
tatgtgactggggagttcaggttccgccgtggctattgcaaaggaaaccctagaaaaatg
gtgaagacgtgggcagagaaggagatgaggaatttgtccaggttaagaacagcaaacata
ccatgcccagaaccaatcaggctaagaagtcatgttctcctcatgagcttcattggcaag
gatgacatgcctgcaccacttttgaaaaatgtccagttgtcagaatccaaggcacgggag
ctgtacctgcaggtcattcagtacatgaggaaaatgtatcaggatgccagacttgtccat
gcagatctcagtgaattcaacatgctgtaccatggtggagatgtatatatcattgatgtt
tctcagtctgtggagcatgaccacccacatgcattggagttcttgagaaaagactgtgcc
aatgtcaatgatttctttttcaagcatgctgttgctgtgatgactgtgaaggagctcttc
gagttcgtcacggatccctccatcacccttgagaacatagatgcttatttggaaaaggct
atggaaatagcatctcagaggaccatggaagaaaagactagccaagatcatgtggatgaa
gaggtgttcaaacaagcatatattcccagaaccttaaatgaagtaaagaattatgagaga
gatgtggacataatgatgaggttaaaggaagaggacatggctttgaacactcagcaggac
aatattctataccagactgtcacaggactgaaaaaagatttgtcaggagtccagaaggtc
cctgcgctcctagaaagtgaagttaaggaagagacttgttttgattcagacgatgctggg
agctctgagtgctctgacacagaccctgaagagcagggagatcaagccggatgccaaaac
catactgctgaccctgacgttgataaaaaggaaagaaaaaagatggtcaaggaagcccag
agagagaagagaaaaaataaaatccctaaacacgtgaaaaaaagaaaggaaaaaacagcc
aaggccaaaaagggcaaatag

DBGET integrated database retrieval system