KEGG   Rattus norvegicus (rat): 291069
Entry
291069            CDS       T01003                                 

Gene name
Ppp1r3g, RGD1308930
Definition
(RefSeq) protein phosphatase 1, regulatory subunit 3G
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: CBM_21 CBM53 Dehydrin
Other DBs
NCBI-GeneID: 291069
NCBI-ProteinID: XP_006222440
RGD: 1308930
Ensembl: ENSRNOG00000016222
UniProt: M0R4A0
Position
17p12
AA seq 347 aa
MEASGEQLHRSEASSSTSSEDPPPAEELSVPEVLCVESGTSEVPIPDDQLQDRLLSAQKV
AALPEQEELQEYRRSRVRSFSLPADPILQAAKLLQQRQQAGQPSSEGGEPAGDCCSKCKK
RVQFADSLGLSLASVKHFSEAEEPQVPPAVLSRLHSFPLRAEDLQQLGELLAVAKVPAPL
LTPRAQLRPLFQLPGLIAAEERLRRQRVCLERVQCSQPPRAEVTGSGRVISCPGPRAVAV
RYTFTEWRTFLDVPAELHPESLEPLSPVRSGNSGPGAEDSEGEPGTERFCFSLCLPPGLQ
PKEGEDADTWGVAIHFAVCYRCEQGEYWDNNEGANYTLRYVCSTDPL
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggaagcctcgggagagcagctacacagatccgaggcgtccagctctacgtcttctgaa
gatccgccacccgctgaagagctgtcggtccccgaggtcctttgcgtggagagcggcacc
tctgaggtcccgatccctgacgatcagctccaggacaggctcctgtcggctcagaaagtg
gcagctctcccggaacaggaggagctacaggaatatcgccgctcgcgtgtgcgctccttc
tctttgcctgcagaccctatcctgcaggcggccaagctcctgcagcagaggcagcaggcg
gggcagcccagttcagagggtggcgagccggctggggactgctgctccaagtgtaagaag
cgcgtgcagttcgccgactccctgggactgagcctggccagcgtgaagcacttcagcgag
gctgaggagcctcaggtgccgcccgccgtgctctcccgtctccacagctttccgctgcgc
gccgaggacctgcagcagctcggggagctgctggcagtggcaaaggtgcccgcgcccctc
ttgacgccgcgcgcccagctccgacccctcttccagctcccggggctgatcgctgcagag
gagcgtctgaggcgacagcgagtgtgcctagagcgtgtgcaatgctcccagccgccccgc
gccgaggtgaccggctcgggccgggtgatcagctgtcccggacccagggcagtagcggtg
cgctacactttcaccgagtggcgcacatttctggacgtgccggccgaacttcacccggag
tccctggagcctctgtctcccgtgaggtcggggaactctggaccaggggctgaggatagt
gagggggagccgggcaccgagcgtttctgcttctcgctgtgcctgcccccgggtctgcag
cccaaagaaggagaggatgctgacacgtggggggtcgctattcattttgccgtctgctac
cgctgtgaacaaggtgaatactgggacaacaacgagggggccaactacaccttgcgctat
gtgtgctccacagacccgctctga

DBGET integrated database retrieval system