KEGG   Rattus norvegicus (rat): 291071Help
Entry
291071            CDS       T01003                                 

Gene name
Rpp40
Definition
(RefSeq) ribonuclease P/MRP 40 subunit
  KO
K14530  ribonucleases P/MRP protein subunit RPP40 [EC:3.1.26.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03008  Ribosome biogenesis in eukaryotes
rno03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    291071 (Rpp40)
   03008 Ribosome biogenesis in eukaryotes
    291071 (Rpp40)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    291071 (Rpp40)
   03016 Transfer RNA biogenesis [BR:rno03016]
    291071 (Rpp40)
   03029 Mitochondrial biogenesis [BR:rno03029]
    291071 (Rpp40)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     291071 (Rpp40)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    RNase MRP
     291071 (Rpp40)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  5'processing factors
   Ribonucrease P
    291071 (Rpp40)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    291071 (Rpp40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribonuc_P_40
Motif
Other DBs
NCBI-GeneID: 291071
NCBI-ProteinID: NP_001013073
RGD: 1310228
Ensembl: ENSRNOG00000016226
UniProt: Q5BK64
Position
17p12
AA seq 303 aa AA seqDB search
MEMGPYYSVKKLPLHELITHEFINTFVKKGSLSALTYNTSIDEDNTVALLPNGKLILSLD
KDTYEETGLQGHPSRYSGRKSMRFIISIDLMDLSLNLDSKKYRRISWSFKEKKPLKFDFL
LAWHHTGTEESTMMSYFSKYQIREHQPKVALSTVRDLQCPVLQSSSLAGEPEEACNALEF
FDWLGAVFCNADLNNEPHNFISTYCCPQPNTVAAQACLCTITGFVLPEKILVLLEQLCHY
FDEPKLAPWVTLTVQGFADSPVAWREKEHGFHKGGEHLYNFVVFNNQDYWLQMAVGANDD
CPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgggaccctattactctgtgaagaagttacctcttcatgaattaattacacat
gaattcatcaacacctttgtaaagaaaggttcactctctgcattaacgtacaatacaagt
attgatgaggataatactgttgctctcctaccaaatgggaaattaattttatcactggat
aaagatacttatgaagagactggactccaaggccatccatctcggtattctggcagaaaa
agtatgaggtttatcatttccattgatctaatggatttatcccttaacctggattctaag
aaatacagaagaatatcttggtccttcaaagaaaagaagcctttgaagtttgatttcctt
ttggcttggcatcatacaggtacagaagaatcaacaatgatgtcatacttttccaaatac
caaattcgggagcatcagccaaaagtggccttgagcacagtaagagatctgcagtgccca
gtgcttcagagcagcagccttgcaggggagccggaggaggcctgcaatgccctggagttc
ttcgactggcttggtgccgtcttctgcaacgcggacctaaataatgaacctcataatttc
atatcaacctactgctgtccacagccaaacacagtggcagcccaagcttgtctgtgtaca
atcacaggtttcgtgttgccagagaagatacttgtccttctggaacagctgtgtcactac
tttgatgaaccgaagttggctccatgggtcaccttgacagttcaaggctttgcagacagc
cccgttgcatggagggagaaggaacacggcttccacaaaggaggagagcacttgtacaat
tttgttgttttcaataatcaggactattggcttcagatggctgttggagcaaatgatgac
tgcccaccataa

DBGET integrated database retrieval system