KEGG   Rattus norvegicus (rat): 291100Help
Entry
291100            CDS       T01003                                 

Gene name
Irf4
Definition
(RefSeq) interferon regulatory factor 4
  KO
K09445  interferon regulatory factor 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    291100 (Irf4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    291100 (Irf4)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    291100 (Irf4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRF-3 IRF
Motif
Other DBs
NCBI-GeneID: 291100
NCBI-ProteinID: NP_001099578
RGD: 1308050
Ensembl: ENSRNOG00000061070
Vega: OTTRNOG00000001790
UniProt: D3ZEX6
Position
17p12
AA seq 450 aa AA seqDB search
MNLETGSRGSEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSVFRIPWKHAGKQ
DYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISD
PYKVYRIVPEGAKKGAKQLTLEDTQMAMGHPYPMTAPYGSLPTQQVHNYMMPPHDRSWRD
YAPDQSHPEIPYQCPVTFGPRGHHWQSPSCENGCQVTGTFYACAPPESQAPGIPIEPSIR
SAEALALSDCRLHICLYYRDILVKELTTSSPEGCRISHGHTYDVSNLDQVLFPYPDDNGQ
RKNIEKLLSHLERGLVLWMAPDGLYAKRLCQSRIYWDGPLALSSDRPNKLERDHTCKLFD
TQQFLSELQVFAHHGRPAPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYFFAQQN
SGHFLRGYELPEHISTPDYHRSLRHSSIQE
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaacttggagacgggcagccggggctcagagttcggcatgagcgcggtgagctgcggc
aacgggaaactcagacagtggctgatcgaccagatcgacagcggcaagtaccccgggctg
gtgtgggagaacgaggagaagagcgtcttccgcatcccgtggaaacacgcgggcaaacag
gactacaaccgggaggaggacgcagccctcttcaaggcttgggcactatttaaaggcaag
ttccgagaagggattgacaagccagatcctcctacttggaagacaagattacgatgcgct
ctgaacaagagcaatgactttgaggaactggtagagaggagtcagctggatatctccgac
ccatacaaggtctacaggattgttccagagggagccaaaaaaggagcaaagcagctcact
ttggaagacacacagatggccatgggccacccctaccccatgacagcaccttatggctct
ctgccaacccagcaggttcataactacatgatgccaccccatgacaggagctggagggat
tatgcccctgaccagtcacacccagaaatcccatatcaatgtcctgtgacgtttggcccg
cgcggccaccactggcaaagcccatcttgtgaaaatggttgccaggtgacaggaaccttt
tatgcttgtgccccacctgagtcccaggctcctggaatccccattgagccaagcataagg
tctgctgaagccttggcgctctcagactgccggctgcatatctgcctgtattaccgggac
atcctcgtgaaggagctgaccacgtccagccccgagggctgccggatctcccacggacat
acctatgatgttagcaacctggaccaagtcctgttcccctaccccgacgacaatgggcag
aggaagaacattgagaagttgctgagccacctggagaggggactggtcctctggatggcc
ccagatgggctttatgccaaaagactgtgccagagcaggatctactgggatgggcccctg
gcactgtccagtgatcggcccaacaaactagaaagagaccacacttgcaagctctttgac
acgcagcagtttctatcagagctacaagtgtttgctcaccacggccggccagcaccgaga
ttccaggtgactctgtgctttggggaggagtttccagaccctcagagacagaggaagctc
atcacagctcatgtggaacctctgctagccagacaactgtatttttttgctcaacaaaac
agtggacattttctgaggggctatgaattacctgaacacattagcactccagattaccac
cggtccctccgtcattcttccatccaagagtga

DBGET integrated database retrieval system