KEGG   Rattus norvegicus (rat): 291103Help
Entry
291103            CDS       T01003                                 

Gene name
Uqcrfs1, LRRGT00195
Definition
(RefSeq) ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
Module
rno_M00151  Cytochrome bc1 complex respiratory unit
rno_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    291103 (Uqcrfs1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    291103 (Uqcrfs1)
  09159 Environmental adaptation
   04714 Thermogenesis
    291103 (Uqcrfs1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    291103 (Uqcrfs1)
   05012 Parkinson disease
    291103 (Uqcrfs1)
   05016 Huntington disease
    291103 (Uqcrfs1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    291103 (Uqcrfs1)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     291103 (Uqcrfs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCR_TM Ubiq-Cytc-red_N Rieske
Motif
Other DBs
NCBI-GeneID: 291103
NCBI-ProteinID: NP_001008888
RGD: 628838
Ensembl: ENSRNOG00000018281
UniProt: P20788
Position
17p12
AA seq 274 aa AA seqDB search
MLSVAARSGPFAPVLSATSRGVAGALRPLLQSAVPATSEPPVLDVKRPFLCRESLSGQAA
TRPLVATVGLNVPASVRYSHTDIKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTAT
TTVGVAYAAKNAVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRT
KKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHG
SHYDASGRIRKGPAPLNLEVPTYEFTSGDVVVVG
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcggtcgctgcccgctcgggcccgttcgcgcccgtcctatcggccacgtcccgc
ggggtggcgggagcgctgcggcccctgctgcaaagcgcggtgcccgccacctcggaacca
ccggttctggacgtgaagcgacccttcctgtgccgtgagtcgctgagtggccaggccgcg
acccgtcctttggtggccacagtgggcctgaatgttcctgcttctgttcgttattcccac
acagacatcaaggtgcccgacttctctgactatcgccgtgctgaagttctagatagcaca
aaatcttctaaagagagcagtgaggctagaaaaggcttctcttacttggtaactgcaact
actactgtgggtgttgcatacgctgcgaaaaatgcagtctcccagtttgtttccagcatg
agtgcttctgcggatgtactggccatgtcgaagatcgagatcaagttgtctgatattcca
gaggggaagaacatggcttttaaatggagaggcaaacctctgtttgtgcgccatagaacc
aagaaggagattgaccaggaagctgcagttgaagtgtcccagttaagggacccacagcat
gatttagagcgtgtaaagaagcctgaatgggttattctgatcggtgtctgtactcatctt
ggttgtgtacccattgcaaacgcaggagattttggtggctactattgcccctgccatggg
tcacactatgatgcttctggcaggatcaggaagggccctgcacctctcaacctggaagta
cctacctatgagttcaccagtggtgatgtagttgttgtgggttag

DBGET integrated database retrieval system