KEGG   Rattus norvegicus (rat): 291129Help
Entry
291129            CDS       T01003                                 

Gene name
Nrsn1, Vmp
Definition
(RefSeq) neurensin 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Neurensin Rhabdo_ncap_2
Motif
Other DBs
NCBI-GeneID: 291129
NCBI-ProteinID: NP_001099579
RGD: 1307833
Ensembl: ENSRNOG00000017444
UniProt: B2RYS1
Position
17p11
AA seq 196 aa AA seqDB search
MTSCSNTCGSRQAQADTEGGYQRRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPNRWSS
VFWKVGLISGTVFVILGLTVLAVGFLVPPKIEAFGEADFMVVDTHAVQYNGALDTCKLVG
AVLFCIGGTSMAGCLLMSVFAKSYSKEEKFLQQKFKERIADIKAHTQPITKTPGPGDTKI
PVTLSRVQNVQPLTAT
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctgcagcaacacctgtgggtccaggcaagcccaggctgacactgagggtggg
taccagcggcgctatggagttcggtcctacctgcatcagttttatgaggactgcactgcc
tctatctgggagtatgaggatgatttccagatccagagatcgcctaacaggtggagctca
gtattctggaaggtcggactcatctcaggcactgtctttgtgattctcggactaactgtc
ctggcagtgggctttcttgtgccccccaaaatcgaagcttttggtgaagccgatttcatg
gtggtggacacacatgctgtgcagtacaacggcgccctggacacatgcaagctagtcggg
gctgtgctcttctgcattgggggcacatccatggcagggtgcctactgatgtctgtgttt
gccaagagctattccaaagaagaaaagttccttcaacagaagtttaaagagagaattgca
gacattaaagcccatacccaacccatcactaaaactccaggccctggggacaccaagatc
cctgtcactttgtccagagttcagaatgtgcagcctctaacagccacctga

DBGET integrated database retrieval system