KEGG   Rattus norvegicus (rat): 291132Help
Entry
291132            CDS       T01003                                 

Gene name
Gpld1
Definition
(RefSeq) glycosylphosphatidylinositol specific phospholipase D1
  KO
K01127  glycosylphosphatidylinositol phospholipase D [EC:3.1.4.50]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    291132 (Gpld1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.50  glycosylphosphatidylinositol phospholipase D
     291132 (Gpld1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FG-GAP Zn_dep_PLPC VCBS
Motif
Other DBs
NCBI-GeneID: 291132
NCBI-ProteinID: NP_001093982
RGD: 631371
Ensembl: ENSRNOG00000017702
UniProt: Q8R2H5 G3V8B1
Position
17p11
AA seq 843 aa AA seqDB search
MSVGRLWSGLLLLLLFFCSRSSSCGLSTHVEIGHRALQFLQLQDGRINYKELLLEHQDAY
QAGTVFPDAFYPSICKQGKFHEVSESTHWTPFLNASIHYIRENYPLPWEKDTEKLVAFLF
GVTSHMVADVSWHSLGIEQGFLRTMGAIDFYDSYSEAHSAGDFGGDVLSQFEFNFNYLSR
RWYVPIQDLLRIYDNLYGRKVITKNVIVDCTYLQFLEMHGEMLAVSKLYSTYSTKSPFLV
EQFQDYFLGGLDDMAFWSTNIYRLTSFMLENGTSDCNLPENPLFISCDGRKNHTLSSSKV
QKNDFHRNLTMFISKDIRKNLNYTERGVFYSTGSWAPESVTFMYQTLERNLRMMFTGNSQ
TALKHVSSPSASYTLSVPYARLGWVMASADLNQDGHGDLVVGAPGYSHPGRFQIGRVYII
YGNDLGLPPIDLDLDKEAHGVLEGFQPSGRFGSALAVLDFNKDGLPDLAVGAPSVGSGQL
TYNGSVYVYYGSQQGRLSSSPNITISCKDTYCNLGWALLAADADGDGQHDLVISSPFAPG
GGKQRGIVAAFYSHPRRNDKESLTLDEADWKVNGEEDFSWFGYSLHGVTVANRSLLLIGS
PTWKNISRMARSSHQKNQEKKSLGRVYGYFPPNRQREITISGDKAMGKLGTSLSSGYVRV
NGTLTQVLLVGAPTHDDVSKMAFLTMTLHQGGATRMYELAPEKTQPALLSTFSGDRRFSR
FGSVLHLTDLDDDGLDEIIMAAPLRITDVTSGLLGGEDGRVYIYNGMHTTLGDVTGKCKS
WMTPCPEEKAQYVLISPEASSRFGSSLVSVRSKERNQVVVAAGRSSWGARLSGALHVYSF
SSD
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaggcaggctgtggtctggcctgctgctcctgctgctttttttctgctctaga
agttcatcttgtggtctctcaacacatgtagaaataggacacagggctctgcagttcctt
cagcttcaagatggacgcattaactacaaagagctgctcttagaacaccaggatgcatat
caggcagggacggtgtttcctgatgccttttaccctagcatctgcaaacaaggaaaattc
catgaagtgtctgagagtactcactggactccatttcttaatgccagcattcattatatt
cgggagaactaccctctgccctgggagaaggacacagagaagttggtggctttcttgttt
ggagtcacctcccacatggtcgctgatgtcagctggcacagcctgggtattgaacaaggg
ttcctcaggacaatgggagctattgatttttacgactcttattctgaggctcattcggct
ggtgattttggaggagatgtgttgagccagtttgaatttaattttaattacctctcacgg
cgctggtacgtgcccatccaagatcttctgagaatttatgataatctctacggtcggaaa
gtcatcaccaagaatgtcattgttgattgcacataccttcagttcctggaaatgcacggg
gagatgctagctgtttccaagctctattccacatactctacgaagtccccatttctggtg
gaacagttccaagactatttcctcggaggtctagatgacatggccttctggtccacgaac
atttaccgtttgaccagctttatgctggagaacgggaccagtgactgcaacctgcctgag
aaccctctgttcatctcctgtgatggtaggaagaaccacaccctcagcagctcaaaagtg
cagaaaaatgattttcacaggaatttgaccatgtttataagtaaagacatcaggaaaaac
ctcaactacacagaaagaggcgtgttctacagcacaggctcctgggccccggaatccgta
acctttatgtaccagactctggagaggaacctgaggatgatgtttactggcaactctcag
acagctctgaagcatgtctccagtccctctgcctcctacaccctgtctgtcccctatgcc
aggctcggctgggtcatggcctcagctgacctcaaccaggatgggcacggcgacctcgtg
gtgggtgcaccaggctacagccaccctggccgcttccagatcgggcgggtgtacatcatc
tatggcaatgatttgggcctgccccccatcgacctggacttagacaaggaggctcatggg
gtcctggagggcttccagccttcaggtcgctttggctcagctttggcagtgctggacttc
aacaaggatgggctgcctgatctggctgtgggtgctccctccgtgggctcagggcagctc
acctacaatggctctgtgtatgtctactatggttcccagcaagggaggttgtcttcttcc
cctaacatcaccatctcctgcaaggacacctactgtaatttgggctgggctctcttggca
gcagacgcagatggagatggccagcatgatctggtgatcagttcaccttttgcaccaggt
ggagggaagcagagaggaattgtggctgccttttattcacaccccagacggaacgacaaa
gagtcactgactttggacgaagctgactggaaggtgaacggggaggaggacttctcatgg
tttggatactcccttcatggggtcacagtggcaaacagaagcctgctgctgattgggagc
ccgacctggaagaatatcagcaggatggcacgctcaagccaccaaaagaaccaagagaaa
aagagcctgggaagggtgtatggctacttccccccaaaccggcagagggaaatcactatc
tcgggagataaggcaatgggaaagctgggtacatccctgtccagtggttatgtgagggtg
aatggcaccctaacccaagtcctgctggttggagcccctactcatgatgacgtgtctaaa
atggcattcctaaccatgaccctgcaccagggtggagccactcggatgtacgagctagcc
cctgagaagacacagcctgctctgctcagcaccttcagcggagaccgacgtttttctcga
tttggtagtgttctacacctgacagacctggatgacgatggcttagatgaaatcatcatg
gctgccccactgaggataacagatgtcacttctggactgcttgggggagaagatgggcga
gtgtacatttataatggcatgcataccaccttaggtgatgtgacaggcaaatgcaagtcc
tggatgactccatgtccagaggagaaggcccagtatgtgctaatttctccagaggcaagt
tcaaggtttgggagctcactggtgtctgtgcggtctaaggaaaggaaccaagtggtcgtt
gctgctggaaggagttcttggggagcccggctctctggggcacttcacgtctacagcttc
agctcagattga

DBGET integrated database retrieval system