KEGG   Rattus norvegicus (rat): 291133Help
Entry
291133            CDS       T01003                                 

Gene name
Aldh5a1, Ssadh
Definition
(RefSeq) aldehyde dehydrogenase 5 family, member A1
  KO
K00139  succinate-semialdehyde dehydrogenase [EC:1.2.1.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00250  Alanine, aspartate and glutamate metabolism
rno00650  Butanoate metabolism
rno01100  Metabolic pathways
Module
rno_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    291133 (Aldh5a1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    291133 (Aldh5a1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     291133 (Aldh5a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 291133
NCBI-ProteinID: NP_074042
RGD: 621422
Ensembl: ENSRNOG00000023538
UniProt: G3V945
Position
17p11
AA seq 523 aa AA seqDB search
MATCFLLRNFCAARPALRPPGRLLREPAGAQRRSYVGGPADLHADLLRGDSFVGGRWLPT
PATFPVYDPASGAKLGTVADCGVPEARAAVRAAYDAFSSWKEISVKERSSLLRKWYDLMI
QNKDELAKIITAESGKPLKEAQGEILYSAFFLEWFSEEARRVYGDIIYTSAKDKRGLVLK
QPVGVASIITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPYSALALAQLANQAGIPPG
VYNVIPCSRTKAKEVGEVLCTDPLVSKISFTGSTATGKILLHHAANSVKRVSMELGGLAP
FIVFDSANVDQAVAGAMASKFRNAGQTCVCSNRFLVQRGIHDSFVTKFAEAMKKSLRVGN
GFEEGTTQGPLINEKAVEKVEKHVNDAVAKGATVVTGGKRHQSGGNFFEPTLLSNVTRDM
LCITEETFGPLAPVIKFDKEEEAVAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGV
NEGLISSVECPFGGVKQSGLGREGSKYGIDEYLEVKYVCYGGL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctgctttctgctgcggaacttctgcgccgcgcgtcccgcgctgcggcctccg
ggccgactcctccgggagcccgcaggggcccagcggcgcagctacgtcggcggcccggct
gacctccacgccgacctgctccgcggggacagctttgtgggcggccgctggcttccaacc
cctgccaccttccctgtgtatgacccggccagcggcgccaagctgggcaccgtggccgac
tgcggggtaccggaggcccgcgctgctgtgcgcgccgcctacgatgccttcagcagctgg
aaagagatctcggtcaaggagaggagctcattgctccgtaaatggtacgacttaatgata
caaaacaaggacgagcttgccaagatcataacagctgagagtggaaagccactgaaagag
gcccagggagagatcctgtattcagcgtttttcctggagtggttctcagaggaagctcgc
cgtgtttatggagacatcatctatacctctgccaaagataagcgaggactggtcctcaag
cagcccgttggtgtggcgtccatcatcacaccgtggaattttcccagtgccatgatcacc
cggaaagtgggggctgccctggcagctggctgcactgtggtggtaaaacctgctgaagat
acaccctattctgccctggccctggctcagcttgcaaaccaggcaggaatccctccaggt
gtctataatgtcattccctgctctagaaccaaggccaaggaagtgggagaggtgctgtgt
actgatcccctcgtgtccaaaatctcctttactggctcaacggcaacgggaaagatcctg
ctgcatcatgcagcaaattctgtgaagcgtgtctccatggagctgggtggcctcgcccca
ttcattgtctttgacagtgccaacgtggaccaggctgtcgcaggagcaatggcatctaaa
tttaggaatgctgggcagacttgcgtttgctcaaacagattcttggtacaacggggtatc
cacgattcctttgtaacgaagtttgcagaagcgatgaagaaaagcctgcgtgtaggtaac
ggatttgaggaaggaacaactcaagggccattaattaatgagaaagctgtagaaaaggta
gagaagcatgtgaatgacgcagttgccaaaggggccacggttgtgacaggcgggaagcga
caccagagcggagggaatttcttcgaacccaccctgctcagcaacgtcaccagggacatg
ctctgcatcaccgaggagacctttgggccgctggcgccagtcatcaagttcgataaagag
gaagaggctgtcgccatcgcaaatgcagctgatgttggattggcaggttacttttactct
caagacccagcccagatctggagagtggcggagcagctggaggtgggcatggttggcgtg
aacgaaggactgatctcttcagtggagtgcccttttggtggggtgaaacagtccggcctt
gggcgagaagggtccaagtatggcattgacgaatatctagaggtcaaatatgtgtgttat
ggaggcttgtag

DBGET integrated database retrieval system