KEGG   Rattus norvegicus (rat): 291135
Entry
291135            CDS       T01003                                 

Gene name
Acot13, Them2
Definition
(RefSeq) acyl-CoA thioesterase 13
  KO
K17362  acyl-coenzyme A thioesterase 13 [EC:3.1.2.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    291135 (Acot13)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-  
     291135 (Acot13)
Lipid biosynthesis proteins [BR:rno01004]
 Fatty acid synthase
  Component type
   291135 (Acot13)
SSDB
Motif
Pfam: 4HBT DUF4442 4HBT_3 DUF5564 Glyco_hydro_47 GPI
Other DBs
NCBI-GeneID: 291135
NCBI-ProteinID: NP_001099581
RGD: 1306513
Ensembl: ENSRNOG00000018415
UniProt: D3ZA93
Position
17p11
AA seq 140 aa
MSNMTQNLREIMKVMFKVPGFDRVLEKVTLVSAAPEKLICEMKVEEQHTNKFGTLHGGLT
ATLVDSISTMALMCTERGAPGVSIDMNITYMSPAKIGEEIVITAHILKQGRTLAFASVDL
TNKATGKLIAQGRHTKHLGN
NT seq 423 nt   +upstreamnt  +downstreamnt
atgagcaacatgacccagaatctacgggaaataatgaaggttatgttcaaagttcccggt
tttgatagagttttggaaaaggtgacacttgtctctgctgctcctgaaaagctaatctgt
gaaatgaaagtggaggagcagcacactaataagtttggtactctccacggcggcttgacg
gcaacccttgtggacagcatatccaccatggctctaatgtgcacagaaagaggggcaccc
ggagtcagtattgacatgaacataacgtacatgtcacctgctaagatcggagaagaaata
gtgatcacagcacatattctgaagcaaggaagaacgctggcatttgcctcagtggatctg
accaacaaggccacaggaaaattaatagcacaaggcagacacacaaagcatctgggaaac
tga

DBGET integrated database retrieval system