KEGG   Rattus norvegicus (rat): 291145Help
Entry
291145            CDS       T01003                                 

Gene name
Hist1h1a
Definition
(RefSeq) histone cluster 1 H1 family member a
  KO
K11275  histone H1/5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    291145 (Hist1h1a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    291145 (Hist1h1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Linker_histone
Motif
Other DBs
NCBI-GeneID: 291145
NCBI-ProteinID: NP_001099583
RGD: 1305706
Ensembl: ENSRNOG00000017175
UniProt: D4A3K5
Position
17p11
AA seq 214 aa AA seqDB search
MSETAPVPQPASVAPEKPAATKKTRKPAKAAVPRKKPAGPSVSELIVQAVSSSKERSGVS
LAALKKSLAAAGYDVEKNNSRIKLGLKSLVNKGTLVQTKGTGAAGSFKLNKKAESKASTT
KVTVKAKASGAAKKPKKTAGAAAKKTVKTPKKPKKPAVSKKTSSKSPKKPKVVKAKKVAK
SPAKAKAVKPKAAKVKVTKPKTPAKPKKAAPKKK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagacagcgccagtccctcagcctgcgtctgttgcccctgagaaacctgccgct
acaaagaaaaccaggaagcctgcgaaagctgctgtccctcgaaagaagcccgcgggacct
tcagtgtctgagctcatcgtgcaggcagtctcatcctccaaggagcgcagcggcgtgtcc
ttggctgcgctcaagaagtcgctggcggcggcgggctacgatgtggagaagaacaacagc
cgcatcaaactcgggctgaagagcctggtgaataagggcaccctggtgcagactaagggt
accggcgctgctggctcctttaagctgaacaagaaggcggagtccaaagccagcaccacc
aaggtgacagtgaaggcgaaagcatccggggcagctaagaaacccaagaagactgctggg
gctgcagcaaagaagactgtcaagacaccgaagaagcccaagaagcctgcagtttcaaag
aagacttcttctaagagcccaaagaagccgaaggtggtcaaggccaagaaggtagccaag
agccctgccaaggcaaaggcagtgaagcctaaggctgccaaggtgaaggtgacaaagcca
aagactccagctaagccgaagaaggcggcgcccaagaaaaagtga

DBGET integrated database retrieval system