KEGG   Rattus norvegicus (rat): 291152
Entry
291152            CDS       T01003                                 

Gene name
Hist1h4m, Hist1h4b, Hist4h4
Definition
(RefSeq) histone cluster 1, H4m
  KO
K11254  histone H4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    291152 (Hist1h4m)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    291152 (Hist1h4m)
  09165 Substance dependence
   05034 Alcoholism
    291152 (Hist1h4m)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    291152 (Hist1h4m)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    291152 (Hist1h4m)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 291152
NCBI-ProteinID: NP_001258150
RGD: 1306905
UniProt: P62804
Position
17q11
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggccgaggtaagggcgggaagggtctgggcaaaggcggcgctaagcgccaccgc
aaagtcctgcgcgacaacatccagggcatcactaagcccgccatccgccgcttggctcgg
cggggaggagtgaagcgcatctccggcctcatctacgaggagacccgcggtgtgctgaag
gtgttcctggagaacgtgatccgcgacgccgtcacctacacagagcacgccaagcgcaag
actgtcactgccatggatgttgtctatgcgcttaagcgccagggccgcactctctacggc
ttcggtggttga

DBGET integrated database retrieval system