KEGG   Rattus norvegicus (rat): 291157
Entry
291157            CDS       T01003                                 

Gene name
Hist1h2bo, Hist1h2bm, Hist1h2bn
Definition
(RefSeq) histone cluster 1 H2B family member o
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    291157 (Hist1h2bo)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    291157 (Hist1h2bo)
  09165 Substance dependence
   05034 Alcoholism
    291157 (Hist1h2bo)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    291157 (Hist1h2bo)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    291157 (Hist1h2bo)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    291157 (Hist1h2bo)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   291157 (Hist1h2bo)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Other DBs
NCBI-GeneID: 291157
NCBI-ProteinID: NP_001099584
RGD: 1311828
Ensembl: ENSRNOG00000054296
UniProt: D3ZNH4
Position
17p11
AA seq 138 aa
MPDPVKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSKILWNKFYYLPSF
NT seq 417 nt   +upstreamnt  +downstreamnt
atgcctgatccggttaagtccgcccccgccccgaagaagggctccaagaaggccgtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaagagagctactcggtg
tacgtgtacaaggtactgaagcaagtgcacccggacaccggcatctcttccaaggccatg
ggcataatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgctgtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaaaatcctgtggaacaaattctattatcttccttccttttaa

DBGET integrated database retrieval system