KEGG   Rattus norvegicus (rat): 291159Help
Entry
291159            CDS       T01003                                 

Gene name
Hist1h2ail1, H3_histone, Hist1h2ail
Definition
(RefSeq) histone cluster 1, H2ai-like1
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    291159 (Hist1h2ail1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    291159 (Hist1h2ail1)
  09165 Substance dependence
   05034 Alcoholism
    291159 (Hist1h2ail1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    291159 (Hist1h2ail1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    291159 (Hist1h2ail1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    291159 (Hist1h2ail1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   291159 (Hist1h2ail1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C PAF CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 291159
NCBI-ProteinID: NP_001013074
RGD: 1311554
Ensembl: ENSRNOG00000046434
UniProt: Q6LED0
Position
17p11
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtactaagcagaccgctcgcaagtccaccggcggcaaggctccgcgcaagcag
ctggccaccaaggctgcccgtaaaagtgccccggccaccggtggcgtgaagaagccccat
cgctaccgtccgggtaccgtagcgttgcgtgagatccggcgctaccagaagtcgaccgaa
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgctcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcctgtgaggcctac
cttgtgggtctgtttgaggacaccaacctatgcgccatccacgccaagcgtgtgaccatc
atgcccaaggacatccagctggcccgccgcattcgtggcgagagggcttga

DBGET integrated database retrieval system