KEGG   Rattus norvegicus (rat): 291161
Entry
291161            CDS       T01003                                 

Gene name
Olr1658, ratchr17-50605392-50606312_ORF
Definition
(RefSeq) olfactory receptor 1658
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    291161 (Olr1658)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    291161 (Olr1658)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    291161 (Olr1658)
SSDB
Motif
Pfam: 7tm_4 7tm_1 UPF0542 SLC3A2_N
Other DBs
NCBI-GeneID: 291161
NCBI-ProteinID: NP_001000105
RGD: 1333681
Ensembl: ENSRNOG00000053920
UniProt: F1M3A7
Position
17p11
AA seq 306 aa
MINQSCQEQFILLGFSDRPRLESILFIFILIFYMVTLVGNIVIILLSHLDPCLHTPMYFF
LTNLSFLDLCFTTSSIPQLLFNLGGQDKSISYIGCAIQLFMFLGLGGTECVLLAVMAYDR
FTAICKPLHYSVIMHSQLCWKLVSVAWSVGLLNSLVMSPVTMKLPRCGRCQVRHFLCEMP
ALIKIACVDTVAVESTVFILSVIIVLVPLILILISYSYIALAVLRIKSASGRRKAFNTCG
SHLTVVSLFYGNIIYMYMQPGHKASQDQGKFLTLFYNLVTPMLNPVIYTLRNKDVKGALK
MLVTRK
NT seq 921 nt   +upstreamnt  +downstreamnt
atgatcaaccagagctgtcaggaacagttcatcctgttaggcttctcagatagaccaagg
ctggaatccatcctcttcatatttatcctcatcttctacatggtgactttagtgggcaac
atcgtcattatcttactttcccatctggacccctgccttcacacccccatgtactttttc
ctcaccaacttgtccttcctagacctctgctttactaccagttccattcctcagttactc
ttcaacttaggaggccaggacaagagcatcagttacattggttgtgcaatccagctgttc
atgtttctaggcctaggaggtactgaatgtgttttgctggctgtcatggcttatgaccgc
ttcactgcaatctgcaagccccttcactactcagtcattatgcattctcagctctgctgg
aagttggtgtctgtagcctggagtgtgggactcctcaattctctggtcatgtctcctgtg
accatgaagctgccgagatgcggcagatgccaggtgaggcacttcctgtgtgagatgcca
gctctgataaaaattgcctgtgtggacactgtggctgtggaaagcactgttttcatttta
tcggtgataatcgtgctggtgcccttgattctcatcctcatttcttacagctatatcgct
ctagcagtgctgaggatcaagtcggcatcaggaaggaggaaggctttcaacacatgtgga
tcccatctcaccgtagtctccttgttttatgggaatatcatctatatgtatatgcagcct
ggacacaaagcttctcaggaccaagggaaatttcttaccctcttctacaacttggtaacc
cccatgttaaaccccgtcatctatacactgagaaacaaggatgtaaagggagcgctgaag
atgctggtgactaggaaataa

DBGET integrated database retrieval system