KEGG   Rattus norvegicus (rat): 291202Help
Entry
291202            CDS       T01003                                 

Gene name
Hax1, HAX-1, Hs1bp1
Definition
(RefSeq) HCLS1 associated protein X-1
  KO
K16220  HCLS1-associated protein X-1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    291202 (Hax1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     291202 (Hax1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 291202
NCBI-ProteinID: NP_853658
RGD: 727960
Ensembl: ENSRNOG00000045647
Vega: OTTRNOG00000001194
UniProt: Q7TSE9
Position
2q34
AA seq 278 aa AA seqDB search
MSVFDLFRGFFGFPGPRSHRDPFFGGMTRDDDDDEDDEEEEDSGAWGRESYAFDGFHPTE
EFGFSFSPRGGMRFHGNFGFDDLVRDFNSIFSEMGAWTLPSHSPELPGPESETPGVRLRE
GQTLRDSMLKYPDSHQPRIFEGVLESHAKPESSKPAPDWGSQGPFHRLDDTWPVSPHSRA
REDKDLDSQVSQEGLGPLLQPQPKSYFKSISVTKITKPDGTVEEHRTVVDSEGRRETTVT
HQEAHDSSRSDPDPPRSSALDDPFSILDLLLGRWFRSR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtctttgatcttttccgaggctttttcggcttccctggacctcggagccacaga
gatcctttttttggagggatgactcgagatgatgacgatgatgaagacgacgaagaggag
gaagacagtggtgcgtggggtcgagagagctatgcgtttgatggttttcaccctacagag
gaattcggtttcagcttcagccccagaggagggatgcgattccatggcaactttggcttt
gatgatctagttcgagattttaatagcatcttcagcgagatgggggcctggaccttgcct
tcccactctcctgaacttccaggtcctgagtcagaaacacctggtgtgagattgcgagag
gggcagacacttcgtgactcaatgcttaagtacccagatagtcaccaacccaggatcttt
gagggggtcttggagagtcatgcaaaacctgaatcctccaaaccagctccagattggggg
tcccagggaccttttcataggttggatgatacatggcctgtgagtccccattctagagcc
agagaggacaaggatcttgactcccaggtttcccaggaaggtctgggtccacttcttcaa
ccccagcctaaatcctatttcaaaagcatctctgtgaccaagatcactaagccagatggg
acagtggaggaacaccgcactgtggtggacagtgagggccggagagagaccacagtgacc
catcaagaagcccatgacagttccagaagtgatccagatcctccaagatcttcagctttg
gatgatcccttttccatcctggacctgcttctaggacgttggtttcggtcccgatag

DBGET integrated database retrieval system