KEGG   Rattus norvegicus (rat): 291206Help
Entry
291206            CDS       T01003                                 

Gene name
Mrpl32
Definition
(RefSeq) mitochondrial ribosomal protein L32
  KO
K02911  large subunit ribosomal protein L32
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    291206 (Mrpl32)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    291206 (Mrpl32)
   03029 Mitochondrial biogenesis [BR:rno03029]
    291206 (Mrpl32)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    291206 (Mrpl32)
  Bacteria
    291206 (Mrpl32)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    291206 (Mrpl32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L32p RecR zf-CHY zf-ribbon_3 DZR DUF5347 NRDD
Motif
Other DBs
NCBI-GeneID: 291206
NCBI-ProteinID: NP_001099586
RGD: 1310541
Ensembl: ENSRNOG00000015989
UniProt: D4AEG6
Position
17q12.1
AA seq 187 aa AA seqDB search
MAPSLLLLSLPWPVRSGPLHRCWELLQRQLKQTWSGFASPQWAPALAVQSPSTLTELAYD
TSKNKENSSFLDSIFWMAAPKNRRTIEVNRCRRRNPHKLIKIKNNIDICPECGHLKQKHV
LCGYCYEKVSQETTKIRQQIWAQEGGPFKAPSIETVVLYTGEKPSEKDQGKRIVERNIKR
PSWFTQN
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggctccttcgctgctgctgctgtcgctcccgtggccagtgcgttccggaccgctacat
aggtgctgggagctgctgcaacggcaactgaagcagacatggagtggctttgccagtcct
cagtgggcaccagcactagcagtccagagcccatccaccctcacggagctagcatatgat
accagtaaaaataaagagaattccagctttttagatagtatcttttggatggcagctccc
aaaaacagacgcaccatcgaagttaaccgatgtaggagaagaaaccctcacaagcttatt
aaaattaagaacaatatagacatttgccctgaatgtggtcacctgaagcagaaacacgtc
ctttgtggctattgctatgagaaagtaagccaagagacaactaaaatcagacaacagata
tgggctcaagaagggggacctttcaaagctccttccatcgagactgtggtactgtacaca
ggagagaaaccatcagaaaaggatcagggcaagaggattgttgaacgaaacataaagaga
ccatcgtggttcacccagaattga

DBGET integrated database retrieval system