KEGG   Rattus norvegicus (rat): 291283Help
Entry
291283            CDS       T01003                                 

Gene name
Akr1c2, Akr1c21
Definition
(RefSeq) aldo-keto reductase family 1, member C2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red DMAP1_like
Motif
Other DBs
NCBI-GeneID: 291283
NCBI-ProteinID: NP_001013075
RGD: 1311841
Ensembl: ENSRNOG00000029844
UniProt: Q6AYQ2
Position
17q12.2
AA seq 318 aa AA seqDB search
MNSKCHCVKLNDGHFIPVLGFGTAMPSELPKSKAKEVTKIAIDAGFHHFDSAFVYNTEDH
VGEAIREKIANGTTRREDIFYTSKLWCTSLHPELVRSSLECSLKKLQLDYVDLYLIHFPM
ALKPGDENFPVDEHGKLLFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNRRQLEKILNKP
GLKYKPVCNQVECHLYLNQMKLLDFCKTNGIILVAYGVLGTQRYNGWVDQNSPVLLNEPV
LSSMAKKYNQTPALIALRHQLQRGIVVLNTSLKEERIKENMKLSPEDMKVLDDLNRNLRY
IAGGIFEGHPNFPFLDEY
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaactccaaatgtcattgtgtgaaactgaacgatggtcatttcattccggtgctgggt
tttggaactgctatgccttcagagttacccaagagtaaagctaaggaggtcaccaaaata
gctatagatgctggtttccatcattttgattctgcttttgtctacaataccgaagatcat
gtaggagaggccatccgagagaagattgccaatggcactacaaggagagaagatatattt
tacacatcaaagctttggtgtacgagccttcacccagaactggtgagatcttccttggaa
tgttcactgaagaaacttcagttggactatgtggacctgtatctcatacattttccgatg
gccttgaaaccaggagatgaaaattttccagtagatgaacatggaaagttactatttgac
acagtagatctctgtgctacctgggaggccatggagaagtgtaaggatgcaggactggcc
aagtccatcggggtgtccaactttaaccgcaggcagctggagaagatcctgaacaagccg
gggctcaaatacaagcctgtgtgcaaccaggtagaatgccatctttatctcaaccaaatg
aaactgctggatttctgcaagacaaatggcattatactggttgcctatggagttctggga
acacaacgatataacggatgggtagaccagaactcccctgttctcttgaatgaaccagtt
cttagttccatggcaaaaaaatacaatcaaactccagccttgattgcccttcgccatcag
ttgcagcgtgggattgtggtacttaacaccagtctcaaagaagagcggatcaaagagaac
atgaagctgagtccagaagatatgaaagtccttgatgacctgaacagaaatttgcggtac
atagctggtggaatatttgaaggccaccctaattttccgtttttggatgaatactaa

DBGET integrated database retrieval system