KEGG   Rattus norvegicus (rat): 291287
Entry
291287            CDS       T01003                                 

Gene name
Tubal3
Definition
(RefSeq) tubulin, alpha-like 3
  KO
K07374  tubulin alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04210  Apoptosis
rno04530  Tight junction
rno04540  Gap junction
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    291287 (Tubal3)
  09143 Cell growth and death
   04210 Apoptosis
    291287 (Tubal3)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    291287 (Tubal3)
   04540 Gap junction
    291287 (Tubal3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    291287 (Tubal3)
   05012 Parkinson disease
    291287 (Tubal3)
   05014 Amyotrophic lateral sclerosis
    291287 (Tubal3)
   05016 Huntington disease
    291287 (Tubal3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    291287 (Tubal3)
   03036 Chromosome and associated proteins [BR:rno03036]
    291287 (Tubal3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    291287 (Tubal3)
   04147 Exosome [BR:rno04147]
    291287 (Tubal3)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     291287 (Tubal3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     291287 (Tubal3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    291287 (Tubal3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   291287 (Tubal3)
  Exosomal proteins of other body fluids (saliva and urine)
   291287 (Tubal3)
  Exosomal proteins of colorectal cancer cells
   291287 (Tubal3)
SSDB
Motif
Pfam: Tubulin_C Tubulin
Other DBs
NCBI-GeneID: 291287
NCBI-ProteinID: NP_001099588
RGD: 1305289
Ensembl: ENSRNOG00000028750
UniProt: F1LUM5
Position
17q12.2
AA seq 382 aa
MDHRTVSLDTFFHETSTGKHVPRTLFMDLEPTVIDGVRVGKYHSLFHPEQLVNGKEDAAN
NYARGRYSAEQCSGLQGFLIYRSFGGGTGSGFTSLLMERLSVEYCKKTKLEFSVYPSPRI
STAVVEPYNAILTTHSTIEYSDCTFMVDNEAVYNICHRKLGVEHPSYSSINRLIAQVLSS
ITASLRFEGPLNVDLIEFQTNLVPYPRIHFPITTLAPIISAEKAYQEHLSVPDITASCFE
LSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNEAIAAMKSRTSVQFVDWCPTGFKVGINC
QPPTVVPGGDLARVQRAVCMLSNTTAIVEAWARLDHKFDLMYAKKAFLHWYITEGMELGE
FEEAREDLAALEKDYEEVGLSF
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggatcacaggactgtatctttagataccttctttcatgagacaagcactgggaagcat
gtgcccagaacacttttcatggacctagaaccaaccgttatagatggcgtccgtgtgggg
aagtaccattcactcttccacccagaacaacttgtgaatggaaaggaggatgctgcaaac
aactatgcacgaggtcgctactctgcagagcaatgcagtggacttcagggatttctgatt
taccgaagctttggaggaggcacggggtcaggatttacatctctcttgatggagcgactc
tctgtagagtattgcaagaagacaaaattggagttctctgtctatccatctcctcgaatc
tccactgcggtggtagaaccgtacaatgccatcctcaccactcactccaccatagaatac
tcagactgtaccttcatggtggacaatgaggctgtgtacaacatctgccatcgcaaactt
ggcgtcgagcatccttcctattcgagtatcaacaggctgattgctcaggtgctgtcttcc
attactgcttccctgcgatttgaaggacctttgaatgtggacttaattgaattccagacc
aacctagtaccttatccacgaatacatttccccatcaccacccttgcccccatcatctct
gctgaaaaggcgtaccaagagcacctctctgtgcctgacatcactgcttcttgctttgag
ctctccaaccagttggtcaagtgtgatccccggcttgggaagtacatggcttgctgctta
ctatacagaggagatgtggtccccaaggatgtcaatgaagcaattgcagccatgaagtcg
aggacctctgttcagtttgtagattggtgtccaactggtttcaaggtgggcatcaattgt
cagccacccacagtggtaccaggaggggatctagccagggttcagcgtgctgtgtgtatg
ttgagcaataccacagcgattgtggaagcctgggcccgcctagaccacaaatttgacctc
atgtacgccaagaaggcatttctgcactggtacatcacagaaggcatggagcttggggag
tttgaagaggccagggaagatctggctgctctggaaaaagattatgaagaagtgggtcta
agtttctga

DBGET integrated database retrieval system