KEGG   Rattus norvegicus (rat): 291352Help
Entry
291352            CDS       T01003                                 

Gene name
Gpr158
Definition
(RefSeq) G protein-coupled receptor 158
  KO
K08469  G protein-coupled receptor 158
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    291352 (Gpr158)
G protein-coupled receptors [BR:rno04030]
 Metabotropic glutamate receptor family
  Unclassified GPCRs
   291352 (Gpr158)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_3 EGF_3
Motif
Other DBs
NCBI-GeneID: 291352
NCBI-ProteinID: NP_001163797
RGD: 1305841
Ensembl: ENSRNOG00000024832
UniProt: A0A0A0MY13
Position
17q12.3
AA seq 1206 aa AA seqDB search
MGAMAYSLLLCLLLAHLGLGEVGASLDPSERPDSSRERTSRGKQHGQQLPRASAPDPSIP
WSRSTDGTILAQKLAEEVPMDVASYLYTGDFHQLKRANCSGRYELAGLPGKSPSLASSHP
SLHGALDTLTHATNFLNMMLQSNKSREQTVQDDLQWYQALVRSLLEGEPSISRAAITFST
ESLSTPAPQVFLQATREESRILLQDLSSSAHHLANATLETEWFHGLRRKWRPHLHRRGSN
QGPRGLGHSWRRRDGLGGDRSHVKWSPPFLECENGSYKPGWLVTLSAAFYGLQPNLVPEF
RGVMKVDINLQKVDIDQCSSDGWFSGTHKCHLNNSECMPIKGLGFVLGAYQCVCKAGFYH
PRVFSVNNFQRRGPDHHFSGSTKDVSEEAHVCLPCREGCPFCADDRPCFVQEDKYLRLAI
ISFQALCMLLDFVSMLVVYHFRKAKSIRASGLILLETILFGSLLLYFPVVILYFEPSTFR
CILLRWVRLLGFATVYGTVTLKLHRVLKVFLSRTAQRIPYMTGGRVMRMLAVIVLVVFWF
LVGWTSSMCQNLERDILLVGQGQTSDNLTFNMCLIDRWDYMTAVAEFLFLLWGIYLCYAV
RTVPSAFHEPRYMAVAVHNELIITAIFHTIRFVLASRLQPDWMLMLYFAHTHLTVTVTIG
LLLIPKFSHSSNNPRDDIATEAYEDELDMGRSGSYLNSSINSAWSEHSLDPEDIRDELKK
LYAQLEIYKRKKMITNNPHLQKKRCSKKGLGRSIMRRITEIPETVSRQCSKEDKEGTDHS
AAKGTGLVRKNPTESSGNTGRPKEESLKNRVFSLKKSHSTYDHVRDQTDESSSLPTESQE
EEVTENSTLESLSSKKLTQKVKEDSEAESTESVPLVCKSASAHNLSSEKKPGHPRTSMLQ
KSLSVIASAKEKTLGLAGKTQTLVMEDRAKSQKPQPKDRETNRKYSNSDNTETKDSGCPN
SNHTEELRKPQKSGIMKQQRVNLPTANPDASSSTTQIKDNFDIGEVCPWEVYDLTPGPVP
SEPKAQKHVSIAASEVEQNPASFSKEKSHHKPKAAEGLYQANHKSIDKTEVCPWESHGQS
PLEDENRLISKTPVLPGRAREENGSQLYTTNMCAGQYEELPPKAVASKVENENLNQMGDQ
EKQTSSSVDIIPGSCISSNNSPQPLTSRAEVCPWEFEPLEQPNAERIVALPASSALSASK
IPGPRK
NT seq 3621 nt NT seq  +upstreamnt  +downstreamnt
atgggagccatggcttactctttactcctctgcctcctgctcgctcatctgggattggga
gaggttggtgccagcctcgacccttcagaacggccagattcttctcgagagaggacttcg
agggggaagcagcacggtcagcagctgccgcgagcctctgccccggacccctctattccc
tggagccgctccacagacggcaccatcttggcacaaaaactagccgaggaggtgcccatg
gacgtggcctcttacctctatactggggacttccaccagctgaagagagccaactgctca
ggccgctatgagttggcgggcctgccggggaagtcaccgtccctagccagctcccatcct
tccttgcacggggcgctggacactctgacacacgccaccaacttcctcaacatgatgttg
cagagcaataagtctcgggagcagaccgtgcaggatgacctgcagtggtaccaggctttg
gtgcgaagtctcctggagggagagcccagcatctcccgggcggccatcaccttcagcacc
gagtcgctgtccacgcccgccccgcaagtcttcctccaggccacccgtgaggagagtcgc
atcctgctgcaggacctgtcctcctccgctcaccacctggctaacgccactctggagacc
gagtggttccacgggcttcggcgaaagtggaggccccacttgcaccgccgcggctccaat
caggggccacggggcctgggccacagctggcggcgcagggatgggcttggcggggacagg
agccatgtcaagtggtctccaccttttctggagtgcgagaatgggagttacaagcccggg
tggctggtcactctctctgctgccttctacgggcttcaacctaacctggtcccggaattc
aggggcgtgatgaaagttgatataaatcttcagaaagtggacattgaccaatgttcgagt
gatggctggttttcaggaacccacaaatgtcaccttaacaactcagagtgtatgccaatc
aaaggcctaggattcgtgctcggagcctatcagtgcgtttgcaaagcaggattctatcat
ccccgtgtcttctcagtgaacaactttcagagaagaggtccagatcaccatttttcagga
agcacaaaggatgtgtcagaagaagcccacgtctgcctgccctgccgagaaggctgcccc
ttctgtgctgatgaccgcccatgttttgtccaggaggataagtacctgcgtctcgccatc
atctccttccaagccctgtgtatgctgctggactttgtcagcatgctggtggtctaccac
ttccgcaaagcaaagagcatcagggcatctggcctcatcttgttggaaacaatactcttt
ggctctctgcttctttactttccggttgttattctgtactttgagccaagtacatttcgt
tgtattctcctgaggtgggttcgtcttctcggttttgcgacagtttatggaactgtgacc
ctcaagcttcacagggttttgaaggtattcctttcaagaacagcacaaagaatcccatat
atgactggcggtcgggtcatgaggatgctggcagtaatagtcttggtagtgttttggttt
ctggttggctggacttcttctatgtgccagaacttggagcgggatatcttgcttgttggc
caagggcaaacatctgataacctcaccttcaatatgtgcctcattgaccgctgggattac
atgacagcagttgctgaatttttattcctcctgtggggcatttatctctgctatgcagtg
cggactgtgccgtcagcattccatgagccacgctacatggctgtcgcagtgcacaacgag
ctcatcatcactgctatattccacacaatcagattcgtgcttgcttcgaggcttcagcct
gactggatgctgatgctgtactttgcacacactcacttgactgtgacagtcaccatcggg
ctgcttctgattccaaagttttcacactcaagcaataatccccgtgatgacatcgccaca
gaagcgtatgaagatgagttggacatgggtcgttctggatcctacctgaacagcagcatc
aattcagcctggagcgagcacagtctagatccagaagacattcgggatgagctgaagaaa
ctctatgcccagttagagatatacaaacgtaagaagatgatcacaaacaacccccacctc
cagaaaaagcggtgctccaagaagggcttaggccggtccatcatgaggcgtatcactgag
atcccagagacggtcagcaggcagtgctccaaagaggacaaggagggcacagatcacagt
gcagccaaagggacaggccttgtccggaagaaccctactgagtcctcagggaacacaggg
agacccaaggaggagtccctgaaaaaccgggtcttttctctcaagaaatcccatagcaca
tatgaccatgtaagagaccaaactgatgaatccagcagcctgcccacagagagccaggag
gaggaggtcacggaaaattcaaccttggagtcgctgtcaagtaaaaaactgacacaaaaa
gtcaaagaagatagcgaggccgagtccacagagtcagtgcccttggtctgcaagtcagcc
agtgctcacaacctcagctctgaaaagaagcccgggcacccacgcacatctatgttacag
aagtcgctcagtgtcattgcaagtgccaaggagaagacactagggctggctggtaaaacc
cagactttagttatggaagaccgagctaagtcccagaaacctcagccaaaagatagagag
acaaacaggaagtactcaaattccgataacacagagactaaagattctggctgcccaaac
tctaatcacacagaggagctaagaaagccccagaaatctgggattatgaaacagcagagg
gtcaacctccccactgccaatcctgacgcgagctccagcaccacccagataaaggacaat
tttgatattggagaagtgtgcccttgggaggtttatgacctgacccccggtcctgtgcct
tcagaaccaaaagctcaaaaacacgtatcaattgcagcttcggaagtggaacaaaaccca
gcttctttttcgaaggagaagtcccaccacaagcctaaggcagctgaaggtctctaccaa
gccaatcacaagagcatagacaagacagaggtgtgcccctgggagagccacggtcagtcc
cctttggaagatgagaatcgtctgatttctaagactccagttctcccagggagagccaga
gaagagaatggaagtcagttgtacacaaccaatatgtgtgctgggcaatatgaagaactg
ccccccaaagccgtagcatcaaaagtagagaatgaaaatctcaaccaaatgggagaccag
gagaaacagacatcttcttctgtggatatcatccctggctcctgtatctcgagtaataac
tcccctcaacccttaacgtcacgagccgaagtgtgtccctgggagttcgagcccctagaa
caaccaaatgctgaaagaatcgtagctttacccgcctcctctgctttaagtgcaagtaag
atacccgggccacggaaatag

DBGET integrated database retrieval system