KEGG   Rattus norvegicus (rat): 291388Help
Entry
291388            CDS       T01003                                 

Gene name
Cbln2
Definition
(RefSeq) cerebellin 2 precursor
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: C1q BclA_C
Motif
Other DBs
NCBI-GeneID: 291388
NCBI-ProteinID: NP_001012758
RGD: 1309715
Ensembl: ENSRNOG00000013654
UniProt: P98087
Position
18q13
AA seq 224 aa AA seqDB search
MPAPGRGPRGPLLSMPGRRGALREPADFGSSLGAALALLLLLLPACCPVKAQNDTEPIVL
EGKCLVVCDSSPSGDGAVTSSLGISVRSGSAKVAFSATRSTNHEPSEMSNRTMTIYFDQV
LVNIGNHFDLASSIFVAPRKGIYSFSFHVVKVYNRQTIQVSLMQNGYPVISAFAGDQDVT
REAASNGVLLLMEREDKVHLKLERGNLMGGWKYSTFSGFLVFPL
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctcctggccggggccccagagggccgctgctgagcatgcccgggcgccggggg
gcgctgcgtgagccggccgactttggctccagcctgggggcggcgctggccctgctgttg
ctgctgctgcccgcctgctgcccggtaaaggctcagaacgacacggagcccatcgtgcta
gagggcaagtgcctggtagtgtgcgattccagtccatcgggggatggcgctgtcacttct
tccctgggcatatctgtgcgctcaggcagtgccaaggtggccttctccgctactcggagc
accaaccacgagccttcagagatgagcaaccgtaccatgaccatctacttcgaccaggtt
ttagtaaacattggcaaccactttgaccttgcctcgagtatatttgtagcaccaaggaaa
ggaatttatagcttcagcttccacgtggtcaaagtgtacaacagacaaactatccaggtc
agtttaatgcagaacggctacccggtgatctctgcctttgctggagaccaggatgttacc
agggaagcagccagcaatggtgttctgcttctcatggaaagagaagacaaagttcatctc
aaactggagagaggcaacctcatgggaggctggaaatactccacattctcgggcttcttg
gtttttcctctatag

DBGET integrated database retrieval system