KEGG   Rattus norvegicus (rat): 291406Help
Entry
291406            CDS       T01003                                 

Gene name
Zfp516, RGD1306817, Znf516
Definition
(RefSeq) zinc finger protein 516
  KO
K22411  zinc finger protein 516
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    291406 (Zfp516)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    291406 (Zfp516)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    291406 (Zfp516)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-H2C2_5 zf-C2H2_6 zf-Di19 zf-C2H2_2 zf-C2H2_3rep zf-C2H2_jaz zf-C2HE
Motif
Other DBs
NCBI-GeneID: 291406
NCBI-ProteinID: NP_001178624
RGD: 1306817
Ensembl: ENSRNOG00000016258
UniProt: D4A239
Position
18q12.3
AA seq 1151 aa AA seqDB search
MDRSREAEMELRRGPSPPRAGRSHEVDGDKAACHSCCICGKSFPFQSSLSQHMRKHTGEK
PYKCPYCDHRASQKGNLKIHIRSHRTGTLIQGHEPEVGEAQLGELRVSEGLDGCASPTKS
TSACNRVLNGAVPTDGSKILLRSSRKEAEGAASAQEDAEAMVQCSFCKSRFERKKDLELH
VHQAHKPFKCRLCSYVTLREESLLSHIERDHITAQVPNGSEACVENGKPELSPGEFPCEV
CGQAFSQTWFLKAHMKKHRGSFDHGCHICGRRFKEPWFLKNHMKAHGPKAGSKNRPKSDL
DPIATINNVVQEEVIVTGLSLYEICTKCGNLFTDLDSLNAHNTVHRKVEASRNPAPAEEG
DTEDPPDTKQFFLQCLNLTPCVAGDVSPSGQAGRRVAELDPVNSYQAWQLATRGKVAEPA
EYLKYGTWDEALAGDVAFDKDKREYILVSQEKRKRESDAPSTQAPPRKRASVPGDPMLSG
HLDPRPASRPNRRAAATTGQGKSSECFECGKIFRTYHQMVLHSRVHRRARRDRDPEGDRA
VRARCGSLSEGDSASQPSSPGSACATADSPGLAEEVVDDSGEEAVSEPASGGQPGHCCSS
GEVAPILLSNGDPSHKLGNNLPEEDISEPTVGIATPSVSILENSSRETTKGPEQHRHSLD
LKMPAFHPRQEASTPERVDFPSSMEIASLQHTLDSQAGHSKEKLSDLHKEHCGVGKRASA
PDLVPLDLSMKSSREDPSSKEASSLQTALVIHPCPYCNHKTYYPEVLWMHKRIWHRISCG
SIAPPWTQPSGHKSICSNLAFLARSGRTGPPPALGGKDCQPLLLARFTRTQVPGGVPGSK
GSSSPLGVTTKAASIPKNKESPSGGPCAPWAPGPDGYRQTRAGHGQDPPSAAVQGPLPKP
KQEASSRLAPSPGSGGLSRSATPTPSVITRVGAQPSANSKPVEKLGVPAVGTGFTPPNKH
SAPDSLKAKFSPQPQGQPPSKGEGGSPLPPREAPVKPAQELRTLATCAAGPRGDAALQAP
PGAPPTLHSIQQEPAAAEGQEKRLDILSIFKYIPKDFATLYQGWGVSSPGPEHRGTPRTQ
ARQGDFVCVECGKSFHQPSQLRAHLRAHTVVFECDSPRGSEVHTASTDTPKQGRDHTAPG
TVPAGPLRKGT
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcagcagagaggctgagatggagctgaggagaggacccagcccacccagggct
ggcaggagccacgaagtggacggggacaaggccgcctgccacagctgttgcatctgcggc
aagagctttcctttccagagctccctgtcccagcatatgcgcaagcacacaggagagaag
ccctacaagtgtccctactgtgaccacagggcttcccagaagggcaacctcaagattcac
atccgcagccaccggacggggactctgatccaggggcacgagccagaggtgggagaggct
cagctgggagagctgcgtgtctccgagggcctggatgggtgtgccagccccaccaagagc
acctctgcctgcaaccgcgtgctgaatggggccgtgccaacggatggcagcaagattctg
ctcaggagcagccgcaaggaagcagagggcgcagccagcgcccaggaagacgccgaggct
atggtgcagtgctccttctgtaagagccggtttgagcgtaagaaggacctggagctgcac
gtgcaccaagcccacaagccattcaagtgcaggctgtgcagctatgtcaccctgcgggag
gagtctctgctcagccacatcgagagggaccacatcactgcacaggtgcccaatggcagc
gaggcctgtgtggagaacggcaagcctgagctgagccctggggaatttccctgcgaggtg
tgtggccaggccttcagccagacctggttcctgaaggcacacatgaagaaacaccgcggc
tcctttgaccatggctgccacatctgtggccggagattcaaagagccctggttcctcaag
aaccacatgaaggcgcatggacccaaggcaggaagcaagaacaggcccaagagtgacctg
gaccccattgctaccatcaacaacgtggtacaggaggaggtcattgtcaccggcctgtcc
ctctatgagatctgcacgaagtgcgggaacctgtttacagacctggacagcttgaacgcc
cacaacaccgtgcaccgtaaagttgaagccagccggaacccagccccggccgaggaaggg
gatacagaagaccccccagacaccaagcagttcttcttacagtgcctgaacctgacacca
tgtgtggctggcgacgtgtcccccagtgggcaggctggacggcgagtggcagagttggac
cctgtcaacagctatcaggcctggcagctggccaccagggggaaggtggccgagccggct
gagtacctcaagtacgggacttgggacgaggcgctggccggggatgtcgcctttgacaaa
gacaagcgtgagtatatactggtgagtcaggagaaacgcaagcgtgaatcggatgctcct
tctacccaggctcccccaaggaagagggccagtgtacctggggaccccatgctttctgga
caccttgacccccggccagcctcacgccccaaccgcagggctgcggccaccactggccag
gggaagtcctctgagtgcttcgagtgcggcaagatcttccgcacctaccaccagatggtg
ctccactcccgtgtgcaccgccgcgcacgccgtgacagggatcctgaaggggaccgggca
gtacgtgcccgctgcggttcactcagcgagggtgattcggcgtcccagccaagcagccct
ggctcagcctgtgccactgctgactcccctggcctggcggaagaagtggtggacgatagt
ggtgaagaggcggtgtctgaacccgcatcaggaggccaaccaggacactgctgctcttct
ggagaggtggcacccatcctgctctccaacggagacccgagtcacaaacttggaaataac
ctgccagaggaagacatcagcgagcccacggtggggatcgccacgccgtctgtgtccata
cttgaaaacagcagcagagagaccaccaagggtcccgagcagcatagacattcccttgac
ttaaagatgccagcatttcaccccaggcaggaagccagcacgcccgagcgggtagacttc
ccctcgagcatggaaatagccagcctgcagcacaccttggacagccaagctgggcattcg
aaagaaaagctgtccgatttgcacaaggagcactgtggggtagggaagcgggcatctgcc
cctgacctggtcccgttggacttgagcatgaagtcgagccgggaagaccccagcagtaag
gaagccagctccctgcagaccgccctagtcattcacccgtgtccttactgtaaccacaag
acctactaccccgaggtcctgtggatgcacaagcgcatctggcacaggatcagctgcggc
tctatagcccctccttggactcagcccagtggccacaagagcatctgcagcaacctggct
ttcctcgcccgcagtgggcgcacagggcccccgcctgctctcgggggcaaggactgccag
cccctgctccttgctcgttttacccgcacccaggtgccaggtggggtaccaggatcaaag
ggcagctcttctccccttggggtgaccacaaaagccgctagcatacctaagaacaaggag
agcccttctgggggcccctgcgctccgtgggcccctggccccgatgggtatcggcagacc
agagccggccatggccaggatccacctagtgctgcagtgcagggacccctgcccaagccc
aaacaggaggctagctccaggctggcaccttccccaggcagtgggggcctcagcagaagt
gccacccctacaccctcagttataacccgtgttggtgcccagccctcagccaacagcaag
ccagtggagaaactcggggtcccggcagtggggactggctttacccctccgaataagcac
agtgccccagactctctgaaagccaaattcagtcctcagcctcagggtcagcctccctcg
aaaggtgaaggaggctctcctctacctccccgagaagcccctgtgaagccggcccaggag
ctgcgaacgctagccacgtgtgcagcagggccccgaggggacgcagccttgcaggctccg
cccggcgcgcctcccaccttacactccatccagcaggagccggcggcagccgagggccag
gagaagcgcctggacatcctcagtatctttaagtacattccaaaggacttcgccacactc
taccagggctggggtgtcagcagccctgggcctgagcacagagggacaccgcggacacag
gcccgccagggagactttgtctgtgtggagtgcggcaagagtttccaccagcccagccaa
ctcagggcccaccttcgggcacacacagtggtgtttgagtgtgacagtccacggggttct
gaagttcacacagcctccacggatacccctaaacaagggagagaccacactgccccaggg
actgtgccggcagggcccctccgaaaggggacctag

DBGET integrated database retrieval system