KEGG   Rattus norvegicus (rat): 29141Help
Entry
29141             CDS       T01003                                 

Gene name
Gal, Galn
Definition
(RefSeq) galanin and GMAP prepropeptide
  KO
K05244  galanin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29141 (Gal)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GMAP Galanin
Motif
Other DBs
NCBI-GeneID: 29141
NCBI-ProteinID: NP_150240
RGD: 61954
Ensembl: ENSRNOG00000015156
UniProt: P10683
Position
1q42
AA seq 124 aa AA seqDB search
MARGSVILLAWLLLVATLSATLGLGMPTKEKRGWTLNSAGYLLGPHAIDNHRSFSDKHGL
TGKRELPLEVEEGRLGSVAVPLPESNIVRTIMEFLSFLHLKEAGALDSLPGIPLATSSED
LEQS
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggccaggggcagcgttatcctgctagcctggctcctgttggttgcaaccctgtcagcc
actctggggctcgggatgccaacaaaggagaagagaggctggaccctgaacagcgctggc
taccttctgggcccacatgccattgacaaccacagatcatttagcgacaagcatggcctc
acaggcaagagggagttaccactggaagtggaggaagggagactaggaagtgttgctgtg
cccctgcctgagagcaatatcgtccgcactataatggagtttctcagtttcttgcacctt
aaagaggccggggccctcgacagcctgcctggcatccccttggccacctcctcagaagac
ctagagcagtcctga

DBGET integrated database retrieval system