KEGG   Rattus norvegicus (rat): 29142Help
Entry
29142             CDS       T01003                                 

Gene name
Vnn1, Tiff66
Definition
(RefSeq) vanin 1
  KO
K08069  pantetheine hydrolase [EC:3.5.1.92]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00770  Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    29142 (Vnn1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.92  pantetheine hydrolase
     29142 (Vnn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 29142
NCBI-ProteinID: NP_001020794
RGD: 1310075
Ensembl: ENSRNOG00000016219
UniProt: Q4KLZ0
Position
1p12
AA seq 512 aa AA seqDB search
MSLSRWLAWAAAFSVFCVLKVSSLDTFLAAVYEHAVILPKVTLLPVSHSEALALMNQNLD
LLEGAILSAAKQGAHIIVTPEDGIYGVQFTRDTIYPYLEDIPDPQVNWIPCDNPERFGST
PVQERLSCLAKNNSIYVVANMGDKKPCNTSDSHCPPDGRFQYNTDVVFDSRGKLVARYHK
QNLFMGEEQFNAPPEPEVVTFDTPFGKFGIFTCFDILFHDPAVTLVTEFQVDTILFPTAW
MDVLPHLAAIEFHSAWAIGMGVNFLAANLHIPLRRMTGSGIYAPDSPRAFHYDRKTQEGK
LLLAQLDSHPSHSPVNWTSYASSVEAPPTEKEEFRSFVFFDEFTFVELKGITGNYTVCQN
DLCCHLSYQMSEKRADEVYALGAFDGLHTVEGQYHLQICILLKCKTTNLRTCGSSVDTAS
TRFEMFSLSGTFGTRYVFPEVLLSEVKLAPGEFQVLSDGRLVSLKPTSGPVLTVGLFGRL
YEKDWASNASSDLIAHSLIIMLILAPIIHYLC
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgtctcggtggctggcgtgggctgcagcgttttccgtcttctgtgtcttaaaa
gtcagctctctggacactttcctcgcagctgtttacgagcatgctgtgatcctgcctaaa
gtcaccctgttacctgtgtctcacagtgaggcactggcattaatgaaccagaatctggac
cttctggaaggagcgatcttatcagcagctaagcagggtgcgcacattattgtgactcca
gaagatggtatatacggtgtgcagttcaccagggataccatctacccatacctggaggat
atcccagaccctcaagtaaactggataccctgtgataatccggaaagatttggctctacc
ccggtgcaggagagactcagctgcttggccaagaacaactcaatctatgtcgtggcgaac
atgggagacaagaagccatgcaacaccagcgactctcactgtccacctgacggccgattc
caatacaacactgatgtggtgtttgattcccggggtaaattggttgccagataccataag
caaaaccttttcatgggagaagagcaattcaatgcccccccggagcctgaggtcgtgact
tttgacaccccctttggaaagtttggcatcttcacctgtttcgatattctcttccatgat
cctgctgtcaccctagtgacagagttccaggtggacaccatactgttcccaactgcctgg
atggacgtgcttcctcatttggcagccattgaattccactcagcttgggctataggcatg
ggagtcaatttcctagcagctaatctacatattcccttgaggagaatgacaggaagtggt
atctatgcacccgattctccacgggcctttcattatgacaggaagacacaggaaggaaag
ctcctccttgcacagctggactctcacccgagtcactccccagtgaactggacttcctat
gccagcagtgtagaagcacccccaactgaaaaggaggaatttcggagttttgttttcttt
gatgagtttacctttgtggagctcaaagggatcacaggaaattacactgtttgccagaac
gacctctgctgtcatctaagctaccagatgtctgagaagcgagctgatgaagtttatgct
cttggggcttttgacgggttgcacaccgtggaagggcagtatcacctgcagatttgcatt
ctgctaaagtgtaaaactaccaatttacgcacctgtggtagttcagtggacacagcttct
accaggtttgaaatgttctccctcagtggcacttttggaacgcggtatgtcttccctgag
gtgttgctgagtgaagtcaagcttgctcctggggagtttcaggtgttgagtgacgggcgc
ctggttagcctgaagccaacgtctggacctgtgttaacagtcggtctctttgggaggttg
tatgagaaggactgggcatcaaatgcttcctcagacctcatagcacactcactgataata
atgctgatcctagctcctattatacattacttgtgttaa

DBGET integrated database retrieval system