KEGG   Rattus norvegicus (rat): 29143Help
Entry
29143             CDS       T01003                                 

Gene name
Grn, PGRN
Definition
(RefSeq) granulin precursor
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Granulin Lustrin_cystein
Motif
Other DBs
NCBI-GeneID: 29143
NCBI-ProteinID: NP_058809
RGD: 61983
Ensembl: ENSRNOG00000021031
UniProt: P23785 G3V8V1 Q6IN42
Position
10q32.1
AA seq 602 aa AA seqDB search
MPPRERGPRRRQTMWILVSWLALVARLVAGTQCPDGQFCPVACCLDQGGANYSCCNPLLD
TWPIITSRRLDGSCQIRDHCPDGYSCLLTVSGTSSCCPFSEGVSCDDGQHCCPRGFHCSV
DGKSCSQISDSLLGAVQCPGSQFECPDSATCCIMIDGSWGCCPMPQASCCEDRVHCCPHG
ASCDLVHTRCISPTGTHPLLKKFPAQRTNRAVAFPFSVVCPDAKTQCPDDSTCCELPTGK
YGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCISKDYTTDLMTKLPGYPVNEVKCDLEVS
CPDGYTCCRLNTGAWGCCPFTKAVCCEDHIHCCPAGFQCHTETGTCELGVLQVPWMKKVT
ASLSLPDPQILKNDVPCDDFSSCPSNNTCCRLSSGDWGCCPIPEAVCCLDHQHCCPQGFK
CMDEGYCQKGDRMVAGLEKMPVRQTTLLQHGDIGCDQHTSCPVGQTCCPSLKGSWACCQL
PHAVCCEDRQHCCPAGYTCNVKARTCEKDAGSVQPSMDLTFGSKVGNVECGAGHFCHDNQ
SCCKDSQGGWACCPYVKGVCCRDGRHCCPIGFHCSAKGTKCLRKKTPRWDILLRDPAPRP
LL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccagggagcgcggaccccgacgcaggcagaccatgtggatcctggtgagctgg
ctggccttagtggcaaggctggtggctggaacacagtgcccagatggtcaattctgccct
gttgcctgctgccttgaccagggaggagccaactacagctgctgtaaccctcttctggac
acatggcctataataacgagccgtcgtctagatggctcctgccagatccgtgaccactgt
cctgatggctactcttgtcttctcactgtgtctgggacttccagctgctgcccgttctct
gagggtgtatcttgtgatgatggccagcactgctgcccccggggcttccactgtagtgtg
gatgggaaatcctgctctcagatatcagatagcctcttgggtgctgtccagtgtcctggt
agccagttcgaatgtcctgactccgccacctgctgtattatgattgatggttcctggggg
tgctgccccatgccccaggcctcttgctgtgaagacagagtgcattgctgtccccacggg
gcctcctgtgacctggttcacacgcgatgcatttcacccacgggcacccaccccttacta
aagaaattccccgcacaaaggaccaacagggcagtggctttccctttttccgtggtgtgc
cctgatgctaagacccagtgccctgatgactctacctgctgtgagctacccactgggaag
tatggctgttgtccaatgcccaacgccatctgctgttccgaccacctgcactgctgcccc
caggacactgtatgtgacctgatccagagcaagtgcatatccaaggactacaccacagat
ctcatgaccaagctgcctggatacccagtgaatgaggtgaagtgcgacttggaggtgagc
tgtcctgatggctacacctgctgccgcctcaacactggggcctggggctgctgtccattc
accaaggctgtgtgttgtgaagaccacattcactgctgcccagccgggtttcagtgtcac
acagagacaggaacctgtgaactgggagtccttcaggtaccctggatgaaaaaggtcacg
gcctccctcagcctgccagacccacagatcttgaagaatgatgtcccctgtgatgacttc
agtagctgtccttctaacaatacctgctgcagactcagttctggggactggggctgctgt
cccatcccagaggctgtctgctgcttagaccaccagcattgctgccctcagggtttcaaa
tgtatggatgaggggtactgtcagaagggagacagaatggtggctggcctggagaagatg
cctgtccgccagacaactctgctccaacatggagatattggttgtgaccagcataccagc
tgcccagtagggcaaacatgctgcccaagcctgaagggaagttgggcctgctgccagttg
ccccatgctgtgtgctgtgaggaccggcagcactgttgcccggctgggtacacctgcaac
gtgaaggcgagaacctgtgagaaggatgcaggctctgtccagccttccatggacctgacc
tttggctctaaggttgggaatgtggaatgtggtgccggacatttctgccatgataaccag
tcctgttgtaaagacagccaaggaggctgggcctgctgtccctatgtaaagggtgtctgc
tgtagagatggacgtcactgttgtcccattggcttccactgttcagccaagggaaccaag
tgtttgcggaagaagacccctcgctgggacatacttttgagggatccagccccaagaccg
ctactgtga

DBGET integrated database retrieval system