KEGG   Rattus norvegicus (rat): 291433Help
Entry
291433            CDS       T01003                                 

Gene name
Dym, RGD1309111
Definition
(RefSeq) dymeclin
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Dymeclin Hid1
Motif
Other DBs
NCBI-GeneID: 291433
NCBI-ProteinID: NP_001099603
RGD: 1309111
Ensembl: ENSRNOG00000018425
UniProt: D3ZP27
Position
18q12.2
AA seq 669 aa AA seqDB search
MGSNSSKISDLPKNEYLKRLSGPEAISENDPFWNQLFSFSFSAPTSSTELKLLEEATISV
CKSLVENNPRTGNLAALTKVFLARTRELRLSAECQNHIFIWQTHNALFIICCLLKVFICE
MSEEELQLHFTYEEKLPGTYSSDSEDLLEELLCSLIQLITDTPLLDITYEISVEAISAMI
VFLSCQLFHKEVLRQSISHKYLMQGPCLPYTSKLVKTLLYNFIRQEKPPPPGTHVFPQQS
DGGGLLYGLASGVATGLWTVFTLGGVGSKAASPELTSPLANQSLLLLLVLVNLTDAPDIP
NPYRQAVTSFKNTQDSSPFPSSVPHTFQINFNSLYTTLCEQQTSDQATLLLYTLLHQNAN
VRTYMLARTDMENLVLPILEILYHVEERNSHHVYMALIILLILTEDDGFNRSIHEVILKN
ITWYSERVLTEISLGSLLILVVIRTIQYNMTRTRDKYLHTNCLAALANMSAQFRSLHQYA
AQRIISLFSLLSKKHNKVLEQATQQADSVTFVRLSDLQSPVAQDLSVIEEVIRMMLEIIN
SCLTNSLHHNPNLVYALLYKRDLFEQFRTHPSFQDIMQNIDLVISFFSSRLLQSGAELSV
ERVLEIIKQGVVALPKDRLKKFPELKFKYVEEEQPEEFFIPYVWSLVYNSAVGLYWNPQD
IQLFAMDSD
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgggatcgaacagcagcaagatcagtgatctacctaagaatgagtacttaaagaggctg
tcaggccccgaggctatctctgaaaacgaccccttctggaatcagctcttctctttttct
ttctctgcaccaaccagcagtactgagttgaagctgttagaagaggcaaccatttcagtt
tgcaagtctttggttgaaaacaaccctcgaacagggaacctcgctgcgctaactaaggtc
ttccttgctagaaccagagagctcaggctttcggccgagtgtcagaaccacatcttcatc
tggcagacacacaatgccttgtttatcatctgctgcctgctgaaggtgttcatctgtgag
atgtctgaggaagagctgcagcttcacttcacgtatgaagaaaagttgcccggcacctac
agttctgactctgaagatcttttggaagaattgctctgcagcttgatacagttaatcact
gacactccactcctggatatcacatatgagatatcagtggaggccatctcagcaatgatt
gtcttcctttcctgtcagctcttccacaaggaggttctgcggcagagcatcagtcacaag
tacctgatgcaaggtccatgtcttccctacaccagcaaacttgtgaaaaccttattatat
aactttatcagacaagaaaagccacctccgcccggaacccatgtcttccctcagcagtcg
gacgggggaggactgctgtatggactggcgtcaggagtagcaactggtctctggaccgtc
ttcacgctaggcggggtgggcagcaaagccgcctctcccgaacttacttcccctctggcc
aaccagagtctcctgctgctgttggtgctggtgaacctgacggatgccccagacatcccc
aacccctacagacaggccgtcacgtcgttcaagaacacacaagacagcagtccgttccca
tcatccgtcccgcacaccttccagattaactttaacagtttgtacacaaccctgtgtgaa
cagcagacgtctgaccaggcaacgctcctcctgtacactctgttgcaccagaacgccaat
gtcaggacgtacatgctggcccggacagacatggaaaaccttgttttaccaattctggag
attctatatcatgttgaggaaagaaactcgcaccatgtctacatggcccttataatcctg
ttgatccttacggaagacgacggcttcaatcggtccattcatgaggtgatattaaaaaac
attacttggtattcagaaagagtcttaactgaaatttccctggggagcctcctaattctg
gtggtaataagaaccatccagtacaatatgaccaggactagagacaagtacctgcacacc
aattgcctggcggcgttagcaaacatgtcagcacagtttcgctccctccaccagtatgct
gcccagaggatcatcagtttgttttctttgctgtctaaaaaacacaacaaggttctggag
caagccacgcagcaggcagactcggttactttcgtgcgtttgagcgacctgcagtctcct
gtggcccaggacctcagcgtcattgaagaagtgattcggatgatgctggagatcatcaac
tcctgcctgactaattctctccaccacaacccgaacttggtgtatgccctgctttacaaa
cgggacctctttgagcaattccggactcacccctcattccaagacataatgcagaacatt
gacctggtaatttccttctttagctcaagactgctacaatctggagctgagctgtcagtg
gaacgggtcttggaaatcattaaacaaggggttgtggcactacccaaagacagactaaag
aaatttccagaactgaaattcaaatacgtggaggaagagcagcctgaggagttcttcatc
ccatacgtctggtctctggtctacaactcggcagttggcctgtactggaacccacaggac
atccaactgtttgccatggactcagactga

DBGET integrated database retrieval system