KEGG   Rattus norvegicus (rat): 291468Help
Entry
291468            CDS       T01003                                 

Gene name
Gykl1, Gk-rs1
Definition
(RefSeq) glycerol kinase-like 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: FGGY_N FGGY_C
Motif
Other DBs
NCBI-GeneID: 291468
NCBI-ProteinID: NP_599168
RGD: 1305596
Ensembl: ENSRNOG00000029096
UniProt: D3Z8F7
Position
18q11
AA seq 549 aa AA seqDB search
MADAPKAVLGPLVGAVDQGTSSTRFLVFNPQTAELLCHHQVEIAQEFPREGWVEQDPKVI
LQSVYECIEKTCEKLGQQSIDISNIKAIGVTNQRETTIVWDKFTGEPLYNAVVWLDLRTQ
STVENLNKSISASNNFIKIKTGLPISTYFSAVKLHWLIENVKNVQKAIEDGRAFFGTVDS
WLIWCMTGGINGGVHCTDVSNASRTMLFNIHSLQWDEELCEFFGIPMTILPRIRSSSEIY
GLMKSGVLEGVPISGCLGDQSAALVGQLCLQDGQAKSTYGTGCFLLCNTGQKCVNSDHGL
LTTVAYKMGREEPVYYALEGSVAIAGAVVSWLKNNLQIIKSSSDIEKLAEKAGTSYGCYF
VPAFSGLYAPYWDPSARGIICGLTQFTNKFHIAFAALEAVCFQTREILDAMNSDCGIPLT
HLQVDGGMTANKILMQLQADILCIPVMKPFMPETTALGAAMAAGAAEGIRVWSLDPKDLT
GVQMEKFEPQINVEESEGRYSTWKRAVMKSMGWVLTQSPDGHDPSIFRSLTLGFYIVSSM
VLLIGARYI
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgctccgaaagcggttttggggccgttggtaggggcagtggaccaaggtacc
agctcaacacgttttttggttttcaatcctcaaacagctgaattactttgtcatcatcaa
gtggaaatagcacaggagttcccaagagaaggatgggtggagcaagacccaaaggtaatc
ctgcagtctgtgtatgagtgtatagagaaaacatgtgagaaacttggacagcagagcatt
gacatttccaacattaaagctattggtgtcaccaaccagcgggaaacgaccatagtctgg
gacaagttcactggagaacctctctacaacgctgtggtgtggcttgacctaaggacccag
tctactgtggagaatctcaacaaaagtatttcagcaagcaataacttcatcaagatcaag
acaggccttccaatcagcacttacttcagtgcagtaaaacttcactggctcattgagaat
gtgaaaaacgtgcaaaaggctatcgaagatggcagagcgttttttgggacggtagactcc
tggctaatctggtgcatgacgggaggtatcaacggaggtgtccactgtacagatgtaagt
aatgcgagtaggaccatgctattcaacattcactctttgcaatgggatgaagagctctgc
gagttttttggaatcccgatgaccatccttcccagaatccggagttcttctgagatctat
ggcctaatgaaaagtggggtgttggaaggtgtgccgatatctgggtgcctgggagaccag
tctgctgctttggtgggacaattgtgcctccaggatggacaagctaaaagcacatatgga
acaggctgtttcttactatgtaacaccgggcagaagtgtgtaaattctgaccacggcctt
ctgaccacggtggcttacaagatgggcagagaggaacctgtctattatgccctggaaggt
tctgtagccatagccggcgctgttgttagctggttaaaaaacaatcttcaaattattaag
tcgtcatcggacattgaaaaacttgctgaaaaagcaggcacttcctatggctgttacttt
gtaccagccttttcaggcttatatgcaccttattgggaccccagtgcaagagggatcatc
tgtgggctcactcagttcaccaataaattccacatcgcatttgctgcattagaagctgtt
tgcttccaaacccgagagattttagatgccatgaacagtgattgtggaatcccgctgaca
catttgcaggtcgacggaggaatgaccgcaaacaaaattcttatgcaactgcaagcagac
attttgtgcatcccagtgatgaaacctttcatgccagaaacaactgccctgggggctgcc
atggctgcaggggcagcagaaggaattagggtgtggagtctggaccctaaggatttaaca
ggtgtccagatggagaagttcgaaccccagatcaatgtcgaggaaagtgaagggcgttac
tccacatggaagagagctgtgatgaagtcaatgggctgggttttgactcagtctcctgat
ggtcacgacccaagtattttcaggagtctgacgctgggtttttatatagtgagtagtatg
gtgttattaattggcgcaaggtacatataa

DBGET integrated database retrieval system