KEGG   Rattus norvegicus (rat): 29153Help
Entry
29153             CDS       T01003                                 

Gene name
Capn1
Definition
(RefSeq) calpain 1
  KO
K01367  calpain-1 [EC:3.4.22.52]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno04210  Apoptosis
rno04217  Necroptosis
rno04218  Cellular senescence
rno05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    29153 (Capn1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    29153 (Capn1)
   04217 Necroptosis
    29153 (Capn1)
   04218 Cellular senescence
    29153 (Capn1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    29153 (Capn1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    29153 (Capn1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     29153 (Capn1)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C2: calpain family
   29153 (Capn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_8 EF-hand_6 EF-hand_1 EF-hand_7
Motif
Other DBs
NCBI-GeneID: 29153
NCBI-ProteinID: NP_062025
RGD: 2267
Ensembl: ENSRNOG00000020935
UniProt: P97571
Structure
PDB: 

Position
1q43
AA seq 713 aa AA seqDB search
MAEELITPVYCTGVSAQVQKQRDKELGLGRHENAIKYLGQDYENLRARCLQNGVLFQDDA
FPPVSHSLGFKELGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNETILHRVVPYGQSFQEGYAGIFHFQLWQFGEWVDVVVDDLLPTKDGKLVFVHS
AQGNEFWSALLEKAYAKVNGSYEALSGGCTSEAFEDFTGGVTEWYDLQKAPSDLYQIILK
ALERGSLLGCSINISDIRDLEAITFKNLVRGHAYSVTDAKQVTYQGQRVNLIRMRNPWGE
VEWKGPWSDNSYEWNKVDPYEREQLRVKMEDGEFWMSFRDFIREFTKLEICNLTPDALKS
RTLRNWNTTFYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEEVDDADDYDSRESGCSFL
LALMQKHRRRERRFGRDMETIGFAVYQVPRELAGQPVHLKRDFFLANASRAQSEHFINLR
EVSNRIRLPPGEYIVVPSTFEPNKEGDFLLRFFSEKKAGTQELDDQIQANLPDEKVLSEE
EIDDNFKTLFSKLAGDDMEISVKELQTILNRIISKHKDLRTNGFSLESCRSMVNLMDRDG
NGKLGLVEFNILWNRIRNYLTIFRKFDLDKSGSMSAYEMRMAIEAAGFKLNKKLHELIIT
RYSEPDLAVDFDNFVCCLVRLETMFRFFKILDTDLDGVVTFDLFKWLQLTMFA
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggagttaatcacacctgtgtactgcaccggggtgtcagcccaagtgcagaag
caacgggacaaggagttgggcttgggccgccatgaaaatgccatcaagtacctgggccag
gattatgaaaatcttcgtgcaagatgcctgcagaacggggtcctcttccaagacgatgcc
ttccctccagtttctcatagcttgggcttcaaggaactgggtcccaattcctctaaaacc
tatggcatcaagtggaagcgtcctacggaactgctgtcaaacccccagttcatcgtggat
ggagccacccgaacggacatctgccagggagcactgggggactgttggctcctggctgcc
attgcctcgctcactctcaacgagactatcctccaccgagtggttccctacggccagagc
ttccaggagggctatgctggcatctttcatttccagctgtggcagtttggggagtgggta
gatgtggttgtggatgatttgctacccaccaaggatggaaagctggtgttcgtgcactct
gcccagggcaacgagttctggagcgctctcctggagaaagcctatgcaaaagtgaatggc
agctatgaggccctttcgggaggctgcacctcagaggccttcgaggactttaccggtggg
gtcactgagtggtacgatctgcagaaggcacccagcgacctctaccagatcattctgaag
gccctggaacgaggctccttgctgggctgctccattaatatctccgatatccgtgatttg
gaggctattacttttaagaacctggtgaggggccatgcatactctgtgacggatgccaag
caggtcacttaccagggccagcgggtgaacctaatccggatgcggaacccctggggtgaa
gtggagtggaaaggaccctggagtgacaactcctatgagtggaacaaagtggacccctat
gaacgtgagcagctgagggtcaagatggaggacggggagttctggatgtccttccgggac
ttcatacgtgagttcaccaaactggaaatctgcaaccttacacctgacgcccttaagagc
agaaccctccggaactggaataccacattttacgagggcacctggcgccggggaagcact
gctggaggctgcaggaactacccagctaccttctgggtaaacccccagttcaagatccgg
ctggaggaggtggatgacgcagacgactatgacagtcgagagtccggctgcagcttcttg
ttggccctcatgcagaagcatcgccgcagggagcgtcgctttggccgggacatggagacc
attggttttgcagtgtaccaggtccctcgggagttggcgggtcagcctgtgcacttgaag
cgtgacttcttcctggccaatgcttctcgggcacaatcagagcactttatcaaccttcga
gaggtcagtaaccgcatccgcctgccgccgggggagtatatagtggtgccctccaccttc
gagcccaacaaagagggtgactttctgctgcgcttcttttcagagaagaaggctgggacc
caggaactagatgaccagatccaggccaacctccccgatgagaaagtgctctctgaagag
gagatcgatgacaacttcaaaaccctgttcagcaagttggcaggggatgacatggagatc
agtgtcaaggagttacagaccatcttgaacagaatcattagcaaacacaaagacctgcgc
actaacggcttcagcctggagtcgtgccgcagcatggtgaacctcatggatcgagacggt
aatgggaaactgggcctggtggagttcaacatcctgtggaaccgcatccgaaattacctg
accatcttccgaaagtttgacctggacaagtctggcagcatgagtgcttatgagatgagg
atggccatcgaggctgcaggcttcaagcttaacaagaagctgcatgagctcatcatcacc
cgctactcagagcccgacctggccgtggactttgacaactttgtgtgctgccttgtgcgc
ctggagaccatgttccggtttttcaaaattctggacacagacctggatggtgttgtgacc
tttgatctatttaagtggttacagctgactatgtttgcatga

DBGET integrated database retrieval system