KEGG   Rattus norvegicus (rat): 291540
Entry
291540            CDS       T01003                                 

Gene name
Cep76, CSG11, RGD1305183
Definition
(RefSeq) centrosomal protein 76
  KO
K16457  centrosomal protein CEP76
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    291540 (Cep76)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    291540 (Cep76)
   Centrosome duplication proteins
    Regulators of centriole replication
     291540 (Cep76)
SSDB
Motif
Pfam: CEP76-C2 Transglut_core3 Transglut_core
Other DBs
NCBI-GeneID: 291540
NCBI-ProteinID: NP_001093984
RGD: 1305183
Ensembl: ENSRNOG00000021918
UniProt: G3V931
Position
18q12.1
AA seq 659 aa
MSLPPEKASELKQLIHQQLSKMDVHGRIREILAETIREELAPDQQHLSTEDLIKALRRRG
IIDDVMKELNFVTDSVDQELPSSPKQTVGFDKQSTLKKTNIDPARRYLYLQVLGGKAFLE
HLQEPEPLPGQICSTFTLCLHYRNQRFRSKPVPCACEPDFHDGFLLEVHRESLGDGTRMA
DSTTMLSISDPIHMVLIKTDIFGETTLVASYFLEWRSVLGSENGVTSLTVELMGVGTESK
VSVGILNIKLEMYPPLSQTLSQEVVNTQLALERQKTAEKERLFLVYAKQWWREYLQIRPS
HNSRLVKIFAQDENGINRPVCSYVKPLRAGRLLDTPRQAARFVNVLGYERAPVIGGGGKQ
EQWCTLLAFLCRNKGDCEDHANLLCSLLLGYGLEAFVCVGTKAKGAPHAWVMTCGTDGTI
MFWESLTGHRYIHKPTNPDEPPLAEQPKPLYPYRTVGCVFNHQTFLGNCQPSDAVETCVF
DLNDESKWKPMSEEAIKSVCAPGATTSLPPFPPLCASTIDASATSNEIEMQLRLLVSEHR
KDLGLTTVWEDQLSYLLSPALASYEFERTTSISAGNEEFQDAIRRAVPDGHTFKGFPIHF
VYRNARRAFATCLRSPFCEEIICCRGDQVRLAVRVRVFTYPESACAVWIMFACKYRSVL
NT seq 1980 nt   +upstreamnt  +downstreamnt
atgtcgctgcctccggagaaagcctctgagctgaagcagctcatccaccagcagctgagc
aagatggatgtccatggcagaataagagaaattcttgccgagactatacgagaagaatta
gcacctgaccaacaacatttatcaacagaagatctgatcaaagctctcagacgtcgagga
atcattgatgatgtaatgaaagagcttaattttgtgactgatagtgttgatcaagaactc
ccttcttctccaaagcaaactgttggttttgataagcagtcaacattaaaaaaaactaac
attgacccagcacggaggtatctttaccttcaggttttgggtggaaaagctttcttggaa
catctgcaggaaccggagcctctgccggggcagatctgctcaactttcactctatgcttg
cactatcggaaccagcggtttcgctcaaagcctgtgccctgcgcttgcgagcctgatttt
cacgacggtttcttgcttgaagttcacagagaaagtttaggtgatgggactagaatggcc
gattcaacaacaatgctatcaataagtgatccaattcacatggtcctaatcaaaacagac
atatttggtgagaccactttagttgcatcctatttcctggaatggagatctgttctgggc
tcagaaaatggagtgaccagcctgactgtggagctcatgggtgtaggcacagaatcaaaa
gtttccgtgggaattttaaatataaaactcgaaatgtacccaccactcagccaaacgctg
tctcaagaagtagtgaacacacagcttgccttggaacgccagaaaactgcagagaaagag
cgattatttctagtttatgctaagcagtggtggagagagtatttgcaaattcgaccctca
cacaattcacggctggtcaagatttttgcccaggatgagaatgggataaatagaccagtt
tgttcctatgttaagccacttcgagctggacgacttctggatactccgagacaagcggct
cgatttgtcaatgtccttggttatgagcgagcccctgtcattggaggaggcggcaagcag
gagcagtggtgcactctgctggctttcctctgtagaaacaagggtgattgtgaagaccac
gctaacctgctgtgcagccttcttcttggatatggactggaggcctttgtctgtgttggg
acgaaggccaagggggcacctcatgcatgggttatgacctgtggaactgatgggaccatc
atgttttgggagagtttaacagggcacaggtacatccacaagcctacgaatcctgatgaa
cctcctcttgctgagcagcccaaacccctgtacccctaccgaacagtcggctgcgttttc
aaccatcagacgttcctggggaactgtcaaccctcggatgcagtagagacatgcgtattt
gatttgaatgatgaatctaagtggaaacccatgagcgaagaagcaattaagtctgtgtgt
gctccaggtgctactacgtctctccctcccttcccccctctgtgcgcgtccacgattgac
gcgtcagccacgagcaatgaaattgaaatgcagctaaggctgctggtgtcggaacacaga
aaggacctcggcctcactactgtctgggaagaccagctctcctatcttttatcaccagct
ttggcttcatatgaatttgagcgaacgacaagcatatctgcaggcaacgaagaattccag
gatgccataaggagggctgtacctgatggccacacatttaaagggttccccatacatttt
gtgtacagaaatgcaaggcgtgcatttgccacttgtcttcggtctcctttttgtgaagaa
ataatctgttgccgtggagaccaggtgcgactggcagttcgtgttcgagtgtttacctac
cctgagtctgcgtgtgctgtttggatcatgtttgcttgtaaatatcgctcggtattatag

DBGET integrated database retrieval system