KEGG   Rattus norvegicus (rat): 291582
Entry
291582            CDS       T01003                                 

Gene name
Slc27a6
Definition
(RefSeq) solute carrier family 27 member 6
  KO
K08749  solute carrier family 27 (fatty acid transporter), member 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
rno04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    291582 (Slc27a6)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    291582 (Slc27a6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    291582 (Slc27a6)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   291582 (Slc27a6)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 291582
NCBI-ProteinID: NP_001099615
RGD: 1311977
Ensembl: ENSRNOG00000058193
UniProt: D4A2B8
Position
18q12.1
AA seq 619 aa
MLLSWLTGFGAGLLSLHFVQKLLFPYFWDDLWFLLKLVRYGIQMEIYKLRGELVTVLDKF
LSHARRQPKKAFIIYEGDVYTYEDVDKRSNRVAHALLNHSDLKRGDVVALLMSNEPDFVH
VWFGLAKLGCVVAFLNSNLRFESLLHCIRTSEPKAMVVGEDLLGSLEEILPSLPKHIRVW
GMKDSVPEGIVSLKEKLSLASDEPVPPSHHVTSSLKSTCLYIFTSGTTGLPKAAVISQFQ
VLKGSFGLWAFGCTADDIVYITLPLYHSSGALLGIGGCVELGATCVLKKKFSASQFWNDC
RKYNVTVFQYIGELCRYLCKQPQREGEKDHRVRLAVGNGMSSDVWRQFLDRFGNIKMCEF
YGATEGNICFMNHTGKIGSVGRVNFFYNLLFSFELIKYDFQKDEPLRNEQGWCYCVRKGE
PGLLVSRVNKKNPFFGYTGSYKQTKSKLLFDVFKKGDVYFNTGDLMFQDHENFLYFWDRI
GDTFRWKGENVATTEVANVLGRLDFIQEANVYGVPVPGYEGKAGMTSIILKPNKSLDLEK
MYDQVVTSLPAYACPRFLRIQDKMETTGTFKLKKLQLVEEGFNPLKIADPLYFMDNLKKS
YVPLTQEIYNQVMLEELKL
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgcttctgtcatggctcacaggatttggggctggactgctctccctccacttcgtgcag
aaacttctgttcccgtacttctgggatgacttgtggttcttgctgaagttggtgcggtat
ggaattcagatggagatatacaaactgaggggtgagctggtcacggtgctggataagttc
ctgagccatgccaggaggcagccaaagaaagccttcatcatctatgagggggatgtgtac
acctatgaggatgtggacaagaggagcaacagagtagcccacgccctcctgaaccactcc
gacctgaaaaggggggacgttgtagctttgttgatgagtaacgagcccgacttcgttcat
gtgtggtttggcctggctaagctgggctgcgtggtggccttcctcaactccaaccttcgc
ttcgagtccctcctacattgcatccgtaccagtgaacccaaagccatggtggtgggcgaa
gatttgcttggaagcctagaagaaatccttcccagcctcccgaaacatatcagggtttgg
ggaatgaaggattctgttccagaaggtatagtttcactcaaagaaaagctgagccttgcc
tctgatgagccagtaccaccaagccatcacgtcacctcaagccttaagtctacttgcctc
tacatttttacctctggaacaacaggtctacccaaagcagctgtgattagccagttccaa
gtgttgaagggatcttttgggctatgggcgtttggctgtacagctgatgacattgtttat
ataaccctccctctgtaccatagctcaggggctctccttggaattggtggatgtgttgag
ttgggtgccacgtgtgtgctaaagaagaaattctctgcgagccagttttggaatgattgc
aggaagtacaacgtgactgtgtttcagtacatcggggagctttgccgttatctgtgtaaa
caacctcagagagaaggggaaaaggaccatcgggtgcgtttggcagttggaaacggtatg
agtagtgatgtgtggagacaatttttagacagatttggaaacattaagatgtgtgaattt
tacggagctaccgaaggaaacatatgtttcatgaaccacactgggaagattggatctgtc
gggagagtgaacttcttctacaatcttcttttctcctttgagttgataaagtatgacttt
cagaaggatgaaccattgaggaacgaacaaggctggtgctactgtgtgagaaaaggagaa
cctggtctccttgtttcccgtgtgaacaagaagaatcctttctttggctatactggctca
tacaagcaaacgaaaagcaagttgctttttgatgtttttaagaagggggatgtttacttc
aacacaggagacctaatgttccaagatcatgagaacttcctttatttttgggaccgtatt
ggagacactttcaggtggaaaggagaaaatgtcgcaaccacagaggtggccaatgtgctt
ggaaggttggactttatacaggaagcaaacgtgtacggtgtgcccgtgccaggttatgaa
ggaaaagctggaatgacttccattattctaaaaccaaacaagtctttagacttagaaaaa
atgtatgaccaagtggtgacatcactaccagcttatgcctgcccacggtttctaagaatt
caggacaaaatggagacaacagggacattcaagctaaagaagttgcagctggtggaagaa
ggatttaatccgctgaagattgctgacccactttactttatggataacttgaagaaatct
tatgttccattgacccaagagatttataatcaggtaatgttagaggagcttaagctttaa

DBGET integrated database retrieval system