KEGG   Rattus norvegicus (rat): 291604
Entry
291604            CDS       T01003                                 

Gene name
Dcp2, RGD1562909
Definition
(RefSeq) decapping mRNA 2
  KO
K12613  mRNA-decapping enzyme subunit 2 [EC:3.6.1.62]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    291604 (Dcp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    291604 (Dcp2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.62  5'-(N7-methylguanosine 5'-triphospho)-[mRNA] hydrolase
     291604 (Dcp2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     291604 (Dcp2)
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     291604 (Dcp2)
SSDB
Motif
Pfam: DCP2 NUDIX
Other DBs
NCBI-GeneID: 291604
NCBI-ProteinID: NP_001163940
RGD: 1562909
Ensembl: ENSRNOG00000045895
UniProt: M0RBQ1
Position
18p11
AA seq 421 aa
METKRLEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQC
GIRDFAKAVFSHCPFLLPQGEDVEKILDEWKEYKMGVPTYGAIILDETLENVLLVQGYLA
KSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGV
PKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLS
RRFGDSSDSDNGFSSAGSTPARPTVEKLSRTKFRHSQQLFPEGSPSDQWVKHRQPLQQKH
SNHTEVSDLCKAKNQNMRGNGRKQYQDSPNQKKRVNGIHGQPTKQQNPLMKCEKKLHPRK
LQDNFETDAACDLPCSGEDPLVEHAEGHSVACNGHCKFPFSSRTFLSFKFDQNAIMKILD
L
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggagaccaaacgcctggaaattcccggcagcgtcctggatgatctctgcagccgattt
attttgcatattcccagtgaggaaagagacaatgcaatccgagtgtgcttccagattgaa
ctcgcccattggttttacttggatttctacatgcagaacacaccaggattacctcagtgt
gggataagagactttgccaaagctgtcttcagtcactgtccatttctgctgccacaaggt
gaagacgtggaaaagattctggatgaatggaaggaatataaaatgggagtaccaacttat
ggtgcaattattctcgatgagacactggagaatgtactgctggttcaggggtacctggca
aagtcaggttggggatttccaaaaggaaaagtaaataaagaagaagcacctcatgactgt
gcagctagagaggtcttcgaggaaactggttttgacataaaagactatatttgtaaggat
gattacattgaacttcgaatcaatgaccagcttgctcgcttgtacatcattccaggagtt
ccaaaagacacaaaatttaaccccaaaaccagaagagaaattaggaatattgagtggttc
tccattgagaagttgccatgtcatagaaacgacatgactcccaagtccaagctcggcttg
gcgcccaataagttttttatggccatcccctttatcagaccactacgggactggctgtct
cgaaggttcggagattcctctgacagtgataatggtttttcctcagctggtagcacacca
gctagacccaccgtggaaaaactgagtcgaacgaaattccgccacagccagcagctgttc
cctgaaggttctcctagtgaccaatgggtaaagcacaggcagccgctgcaacagaagcac
agtaaccacacggaggtgtcggacctttgcaaagcaaagaatcaaaatatgagaggaaat
ggcagaaaacagtatcaagattcacctaatcaaaagaagagagtgaacggaattcacggt
cagccaacaaagcagcagaatcctttgatgaaatgtgaaaagaagctccatccacgaaag
cttcaggacaactttgagacagatgccgcatgtgatttgccttgttctggtgaagaccca
ctggtagaacatgctgagggacattctgtagcatgcaatggacattgcaaattcccattt
tcatccagaacctttctgagtttcaagtttgaccaaaacgctataatgaaaatcttggac
ctttga

DBGET integrated database retrieval system